StarFunc result for job id Q8N0Z6

User Input

>input (440 residues)
MMADEEEEVKPILQKLQELVDQLYSFRDCYFETHSVEDAGRKQQDVQKEMEKTLQQMEEV
VGSVQGKAQVLMLTGKALNVTPDYSPKAEELLSKAVKLEPELVEAWNQLGEVYWKKGDVA
AAHTCFSGALTHCRNKVSLQNLSMVLRQLRTDTEDEHSHHVMDSVRQAKLAVQMDVHDGR
SWYILGNSYLSLYFSTGQNPKISQQALSAYAQAEKVDRKASSNPDLHLNRATLHKYEESY
GEALEGFSRAAALDPAWPEPRQREQQLLEFLDRLTSLLESKGKVKTKKLQSMLGSLRPAH
LGPCSDGHYQSASGQKVTLELKPLSTLQPGVNSGAVILGKVVFSLTTEEKVPFTFGLVDS
DGPCYAVMVYNIVQSWGVLIGDSVAIPEPNLRLHRIQHKGKDYSFSSVRVETPLLLVVNG
KPQGSSSQAVATVASRPQCE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N0Z6	1.000	1.000	4.523E-64	440	1.000	1.000	Q8N0Z6.pdb.gz	TTC5_HUMAN Tetratricopeptide repeat protein 5 OS=Homo sapiens OX=9606 GN=TTC5 PE=1 SV=2
2	PDB:4abnB	0.953	0.984	2.833E-54	426	0.873	0.901	4abnB.pdb.gz
3	PDB:7qwsK	0.945	0.976	3.639E-52	426	0.966	0.998	7qwsK.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
4	AFDB:Q587E6	0.697	0.730	1.716E-16	418	0.202	0.213	Q587E6.pdb.gz	Q587E6_TRYB2 Tetratricopeptide repeat domain 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.40 PE=4 SV=1
5	AFDB:A0A2R8PZ91	0.399	0.168	6.868E-7	1119	0.120	0.047	A0A2R8PZ91.pdb.gz
6	AFDB:Q7KJA9	0.271	0.135	8.531E-7	1059	0.143	0.059	Q7KJA9.pdb.gz	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
7	AFDB:O18158	0.413	0.169	1.260E-6	1151	0.139	0.053	O18158.pdb.gz	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
8	PDB:7ntfA	0.258	0.147	2.059E-6	918	0.136	0.065	7ntfA.pdb.gz
9	AFDB:Q9M8Y0	0.429	0.202	2.415E-6	977	0.093	0.042	Q9M8Y0.pdb.gz	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
10	AFDB:Q5ADP3	0.205	0.089	7.784E-6	1080	0.143	0.058	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
11	AFDB:Q5T4D3	0.291	0.193	8.129E-6	741	0.098	0.058	Q5T4D3.pdb.gz	TMTC4_HUMAN Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
12	AFDB:Q96301	0.301	0.172	8.129E-6	914	0.100	0.048	Q96301.pdb.gz	SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
13	AFDB:Q5CZ52	0.378	0.362	1.054E-5	462	0.095	0.091	Q5CZ52.pdb.gz	BBS4_CAEEL Bardet-Biedl syndrome 4 protein homolog OS=Caenorhabditis elegans OX=6239 GN=bbs-4 PE=1 SV=2
14	PDB:7qdrB	0.379	0.154	4.472E-5	1212	0.100	0.036	7qdrB.pdb.gz
15	PDB:8a3tD	0.346	0.279	6.606E-5	560	0.091	0.071	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:7qe7U	0.333	0.276	7.204E-5	540	0.116	0.094	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:7qe7J	0.393	0.345	7.523E-5	510	0.095	0.082	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:7kw7E	0.223	0.294	9.758E-5	327	0.086	0.116	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
19	PDB:5udkA	0.387	0.371	1.266E-4	461	0.091	0.087	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
20	PDB:6xt9D	0.330	0.357	1.266E-4	396	0.123	0.136	6xt9D.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N0Z6	0.0	910	440	1.000	1.000	TTC5_HUMAN Tetratricopeptide repeat protein 5 OS=Homo sapiens OX=9606 GN=TTC5 PE=1 SV=2
2	Q99LG4	0.0	825	440	0.905	0.905	TTC5_MOUSE Tetratricopeptide repeat protein 5 OS=Mus musculus OX=10090 GN=Ttc5 PE=1 SV=2
3	Q587E6	8.75e-14	75.1	418	0.145	0.153	Q587E6_TRYB2 Tetratricopeptide repeat domain 5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.40 PE=4 SV=1
4	O15294	1.57e-06	53.1	1046	0.141	0.059	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
5	P81436	1.63e-06	53.1	1046	0.141	0.059	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
6	P56558	1.68e-06	53.1	1036	0.141	0.060	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
7	Q8CGY8	1.72e-06	52.8	1046	0.141	0.059	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
8	Q5GA12	2.43e-06	52.4	1052	0.139	0.058	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
9	Q5GA13	2.54e-06	52.4	1062	0.139	0.057	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
10	Q5GA11	2.67e-06	52.4	1046	0.139	0.058	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
11	Q5GA10	2.71e-06	52.4	1036	0.139	0.059	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
12	Q9Y148	3.87e-05	48.5	1011	0.114	0.049	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
13	Q7KJA9	4.60e-05	48.5	1059	0.114	0.047	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
14	A0A0R4IVJ0	2.47e-04	46.2	1102	0.134	0.054	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1
15	O18158	8.54e-04	44.3	1151	0.095	0.036	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
16	Q2L6Y4	0.001	43.5	973	0.095	0.043	Q2L6Y4_CAEEL protein O-GlcNAc transferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=1
17	Q5ADP3	0.002	43.1	1080	0.125	0.051	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
18	O60184	0.021	39.7	1102	0.143	0.057	CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssn6 PE=1 SV=1
19	Q96301	0.024	39.7	914	0.077	0.037	SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana OX=3702 GN=SPY PE=1 SV=1
20	Q86TV6	0.055	38.5	843	0.045	0.024	TTC7B_HUMAN Tetratricopeptide repeat protein 7B OS=Homo sapiens OX=9606 GN=TTC7B PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14355 Abi_C	1.2e+02	14.2	Abortive infection C-terminus
2	PF20225 DUF6584	2.4e+02	13.1	Family of unknown function (DUF6584)
3	PF12569 NatA_aux_su	83	13.6	N-terminal acetyltransferase A, auxiliary subunit
4	PF10602 RPN7	43	15.3	26S proteasome subunit RPN7
5	PF09460 Saf-Nte_pilin	5.1e+02	12.1	Saf-pilin pilus formation protein
6	PF12931 Sec16_C	13	16.9	Sec23-binding domain of Sec16
7	PF20308 TPR-S	1.9e+02	14.0	Tetratricopeptide Repeats-Sensor
8	PF00515 TPR_1	0.00058	30.8	Tetratricopeptide repeat
9	PF13414 TPR_11	2.4e-06	38.5	TPR repeat
10	PF13424 TPR_12	33	16.2	Tetratricopeptide repeat
11	PF13428 TPR_14	2	20.4	Tetratricopeptide repeat
12	PF13432 TPR_16	0.0054	28.6	Tetratricopeptide repeat
13	PF13431 TPR_17	1.3	20.6	Tetratricopeptide repeat
14	PF14559 TPR_19	0.45	22.3	Tetratricopeptide repeat
15	PF07719 TPR_2	0.00018	32.4	Tetratricopeptide repeat
16	PF13181 TPR_8	6.8	18.2	Tetratricopeptide repeat
17	PF13371 TPR_9	9.1	17.8	Tetratricopeptide repeat
18	PF16669 TTC5_OB	9.3e-39	143.2	Tetratricopeptide repeat protein 5 OB fold domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258821

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.991	Histone acetyltransferase p300
2	9606.ENSP00000379441	0.963	Junction-mediating and -regulatory protein
3	9606.ENSP00000319169	0.923	Protein arginine N-methyltransferase 5
4	9606.ENSP00000269305	0.922	Cellular tumor antigen p53
5	9606.ENSP00000372023	0.915	Serine/threonine-protein kinase Chk2
6	9606.ENSP00000278616	0.913	Serine-protein kinase ATM
7	9606.ENSP00000339740	0.863	Calcium/calmodulin-dependent protein kinase type II subunit delta
8	9606.ENSP00000222247	0.800	Belongs to the eukaryotic ribosomal protein eL20 family.
9	9606.ENSP00000225430	0.800	Ribosomal protein L19
10	9606.ENSP00000259469	0.800	60S ribosomal protein L35
11	9606.ENSP00000262584	0.800	60S ribosomal protein L8
12	9606.ENSP00000274242	0.800	60S ribosomal protein L37
13	9606.ENSP00000307889	0.800	Ribosomal protein L13
14	9606.ENSP00000309334	0.800	Ribosomal protein L15
15	9606.ENSP00000309830	0.800	Ribosomal protein L38
16	9606.ENSP00000339795	0.800	60S ribosomal protein L7
17	9606.ENSP00000346001	0.800	60S ribosomal protein L3
18	9606.ENSP00000346015	0.800	Ribosomal protein L27a
19	9606.ENSP00000346027	0.800	60S ribosomal protein L21
20	9606.ENSP00000354739	0.800	60S ribosomal protein L12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043022	0.950	ribosome binding
GO:0003676	0.794	nucleic acid binding
GO:0003723	0.314	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051254	0.990	positive regulation of RNA metabolic process
GO:0010468	0.969	regulation of gene expression
GO:0009987	0.953	cellular process
GO:0009894	0.846	regulation of catabolic process
GO:0050896	0.794	response to stimulus
GO:0009889	0.682	regulation of biosynthetic process
GO:1903311	0.660	regulation of mRNA metabolic process
GO:0010556	0.548	regulation of macromolecule biosynthetic process
GO:0031326	0.548	regulation of cellular biosynthetic process
GO:0009891	0.535	positive regulation of biosynthetic process
GO:0009991	0.438	response to extracellular stimulus
GO:0031329	0.433	regulation of cellular catabolic process
GO:0071496	0.409	cellular response to external stimulus
GO:0010557	0.402	positive regulation of macromolecule biosynthetic process
GO:0071704	0.401	organic substance metabolic process
GO:0044238	0.359	primary metabolic process
GO:0044237	0.359	cellular metabolic process
GO:1903506	0.353	regulation of nucleic acid-templated transcription
GO:0006807	0.349	nitrogen compound metabolic process
GO:0043170	0.340	macromolecule metabolic process
GO:0034641	0.334	cellular nitrogen compound metabolic process
GO:0044260	0.331	cellular macromolecule metabolic process
GO:0051716	0.327	cellular response to stimulus
GO:1903313	0.309	positive regulation of mRNA metabolic process
GO:0031328	0.302	positive regulation of cellular biosynthetic process
GO:0006950	0.300	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0031981	0.996	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0031982	0.885	vesicle
GO:0032991	0.603	protein-containing complex
GO:0031410	0.575	cytoplasmic vesicle
GO:0043232	0.512	intracellular non-membrane-bounded organelle
GO:0016020	0.431	membrane
GO:0005739	0.382	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]