StarFunc result for job id Q8N108

User Input

>input (512 residues)
MAEPSVESSSPGGSATSDDHEFDPSADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAR
EGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKD
SSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKK
EIMVGSMFQAEIPVGICRYKENEKVYENDDQLLWDPEYLPEDKVIIFLKDASRRTGDEKG
VEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRFNVKAAREELSVWTEEECRNFEQGL
KAYGKDFHLIQANKVRTRSVGECVAFYYMWKKSERYDFFAQQTRFGKKKYNLHPGVTDYM
DRLLDESESAASSRAPSPPPTASNSSNSQSEKEDGTVSTANQNGVSSNGPGEILNKEEVK
VEGLHINGPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRR
VNSNGKESPGSSEFFQEAVSHGKFEELENTDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N108	1.000	1.000	3.628E-69	512	1.000	1.000	Q8N108.pdb.gz	MIER1_HUMAN Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2
2	AFDB:Q7Z3K6	0.410	0.385	4.106E-30	550	0.459	0.427	Q7Z3K6.pdb.gz	MIER3_HUMAN Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3 PE=1 SV=2
3	AFDB:Q8N344	0.335	0.318	1.591E-22	545	0.352	0.330	Q8N344.pdb.gz	MIER2_HUMAN Mesoderm induction early response protein 2 OS=Homo sapiens OX=9606 GN=MIER2 PE=1 SV=2
4	PDB:7aoaD	0.253	0.365	9.280E-6	343	0.098	0.146	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
5	AFDB:Q68FM7	0.073	0.040	2.952E-2	1552	0.158	0.052	Q68FM7.pdb.gz	Q68FM7_MOUSE Rho guanine nucleotide exchange factor (GEF) 11 OS=Mus musculus OX=10090 GN=Arhgef11 PE=1 SV=1
6	AFDB:Q923U0	0.075	0.079	4.396E-2	474	0.104	0.112	Q923U0.pdb.gz	TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus OX=10090 GN=Tom1l1 PE=1 SV=1
7	AFDB:Q9ZQ83	0.174	0.191	5.215E-2	450	0.102	0.116	Q9ZQ83.pdb.gz	Q9ZQ83_ARATH ELM2 domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g03470 PE=1 SV=1
8	AFDB:E7FF48	0.111	0.028	8.222E-2	2315	0.184	0.041	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
9	AFDB:Q03388	0.067	0.048	1.225E-1	795	0.180	0.116	Q03388.pdb.gz	VPS72_YEAST Vacuolar protein sorting-associated protein 72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS72 PE=1 SV=2
10	AFDB:Q68CJ9	0.069	0.074	1.824E-1	461	0.143	0.158	Q68CJ9.pdb.gz	CR3L3_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Homo sapiens OX=9606 GN=CREB3L3 PE=1 SV=2
11	AFDB:A0A1D8PTM6	0.073	0.052	2.425E-1	773	0.150	0.100	A0A1D8PTM6.pdb.gz	A0A1D8PTM6_CANAL Fgr32p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FGR32 PE=4 SV=1
12	PDB:4czzB	0.087	0.324	2.466E-1	133	0.047	0.180	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
13	PDB:7c4jB	0.091	0.111	7.697E-1	395	0.043	0.056	7c4jB.pdb.gz
14	PDB:5z56L	0.094	0.135	1.360	342	0.047	0.070	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
15	PDB:6iczL	0.086	0.094	2.026	454	0.047	0.053	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
16	PDB:6k15H	0.081	0.105	2.026	393	0.023	0.031	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
17	PDB:6id0L	0.093	0.099	2.144	475	0.051	0.055	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
18	PDB:5o9zH	0.069	0.079	2.270	413	0.045	0.056	5o9zH.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
19	PDB:6ki0A	0.065	0.071	2.403	459	0.029	0.033	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
20	PDB:3ihpB	0.068	0.051	2.850	681	0.031	0.023	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N108	0.0	1052	512	1.000	1.000	MIER1_HUMAN Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2
2	Q7Z3K6	8.10e-124	375	550	0.467	0.435	MIER3_HUMAN Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3 PE=1 SV=2
3	Q8N344	7.33e-90	287	545	0.352	0.330	MIER2_HUMAN Mesoderm induction early response protein 2 OS=Homo sapiens OX=9606 GN=MIER2 PE=1 SV=2
4	Q7SXR7	1.05e-10	66.6	631	0.105	0.086	Q7SXR7_DANRE Metastasis associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fi29g02 PE=1 SV=1
5	F1QLG2	1.09e-10	66.6	663	0.105	0.081	F1QLG2_DANRE Metastasis-associated 1 family, member 2 OS=Danio rerio OX=7955 GN=wu:fd61b05 PE=1 SV=2
6	A0A0B4KG70	1.85e-10	65.9	922	0.100	0.055	A0A0B4KG70_DROME Metastasis associated 1-like, isoform D OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
7	B7Z0T5	1.99e-10	65.9	853	0.100	0.060	B7Z0T5_DROME Metastasis associated 1-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
8	Q9U6X3	2.03e-10	65.9	841	0.100	0.061	Q9U6X3_DROME LD04853p (Fragment) OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=2 SV=1
9	Q6AWS2	2.14e-10	65.9	857	0.100	0.060	Q6AWS2_DROME SD15071p OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=2 SV=1
10	Q9VNF6	2.34e-10	65.5	880	0.100	0.058	Q9VNF6_DROME Metastasis associated 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=2
11	Q9VNF7	2.42e-10	65.5	844	0.100	0.060	Q9VNF7_DROME Metastasis associated 1-like, isoform B OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=2
12	Q80TZ9	3.55e-10	65.5	1558	0.090	0.030	RERE_MOUSE Arginine-glutamic acid dipeptide repeats protein OS=Mus musculus OX=10090 GN=Rere PE=1 SV=3
13	Q9P2R6	9.99e-10	63.9	1566	0.090	0.029	RERE_HUMAN Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE PE=1 SV=2
14	Q0GGX2	1.04e-09	63.9	1363	0.107	0.040	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
15	Q9R190	5.23e-09	61.2	668	0.100	0.076	MTA2_MOUSE Metastasis-associated protein MTA2 OS=Mus musculus OX=10090 GN=Mta2 PE=1 SV=1
16	B2GV01	5.51e-09	61.2	668	0.100	0.076	B2GV01_RAT Metastasis-associated gene family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
17	F7F888	8.38e-09	60.5	670	0.094	0.072	F7F888_RAT Metastasis associated 1 family, member 2 OS=Rattus norvegicus OX=10116 GN=Mta2 PE=1 SV=1
18	O94776	1.65e-08	59.7	668	0.098	0.075	MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1
19	Q9H0D2	3.87e-08	58.5	1346	0.094	0.036	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
20	Q7ZUE1	8.85e-08	57.0	517	0.096	0.095	Q7ZUE1_DANRE Metastasis associated family, member 3 OS=Danio rerio OX=7955 GN=wu:fj99h01 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01448 ELM2	2.3e-06	39.6	ELM2 domain
2	PF19426 MIER1_3_C	2.1e-10	52.3	Mesoderm induction early response protein 1/3 C-terminal
3	PF00249 Myb_DNA-binding	0.041	25.4	Myb-like DNA-binding domain
4	PF15963 Myb_DNA-bind_7	8.3	17.6	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000016657

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000016053	0.842	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
2	60711.ENSCSAP00000016960	0.842	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
3	60711.ENSCSAP00000017750	0.842	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
4	60711.ENSCSAP00000017088	0.827	Histone demethylase that demethylates both 'Lys-4' (H3K4me) and 'Lys-9' (H3K9me) of histone H3, thereby acting as a coactivator or a corepressor, depending on the context. Acts by oxidizing the substrate by FAD to generate the corresponding imine that is subsequently hydrolyzed. Acts as a corepressor by mediating demethylation of H3K4me, a specific tag for epigenetic transcriptional activation. Demethylates both mono- (H3K4me1) and di-methylated (H3K4me2) H3K4me
5	60711.ENSCSAP00000003568	0.727	Chromodomain protein, Y-like
6	60711.ENSCSAP00000014412	0.727	annotation not available
7	60711.ENSCSAP00000011772	0.693	Histone deacetylase 2
8	60711.ENSCSAP00000011667	0.650	Bromodomain adjacent to zinc finger domain, 1A
9	60711.ENSCSAP00000014763	0.645	Centrosomal protein 57kDa
10	60711.ENSCSAP00000012834	0.631	CCR4-NOT transcription complex, subunit 7
11	60711.ENSCSAP00000006379	0.601	Testis anion transporter 1
12	60711.ENSCSAP00000014471	0.560	Chromodomain protein, Y-like 2
13	60711.ENSCSAP00000003799	0.557	Bromo adjacent homology domain containing 1
14	60711.ENSCSAP00000008654	0.547	Uncharacterized protein
15	60711.ENSCSAP00000011757	0.514	Chromosome 4 open reading frame 48

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042826	1.000	histone deacetylase binding
GO:0004407	1.000	histone deacetylase activity
GO:0140110	0.422	transcription regulator activity
GO:0003712	0.414	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0006325	0.983	chromatin organization
GO:0031323	0.983	regulation of cellular metabolic process
GO:0016570	0.977	histone modification
GO:0098732	0.975	macromolecule deacylation
GO:0010468	0.973	regulation of gene expression
GO:0048583	0.972	regulation of response to stimulus
GO:0016575	0.971	histone deacetylation
GO:0019219	0.968	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.964	positive regulation of cellular process
GO:0010556	0.949	regulation of macromolecule biosynthetic process
GO:0031326	0.949	regulation of cellular biosynthetic process
GO:0051252	0.947	regulation of RNA metabolic process
GO:0006355	0.943	regulation of DNA-templated transcription
GO:0009966	0.930	regulation of signal transduction
GO:0043122	0.862	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048584	0.788	positive regulation of response to stimulus
GO:0009967	0.677	positive regulation of signal transduction
GO:0043123	0.673	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006338	0.540	chromatin remodeling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0005667	0.919	transcription regulator complex
GO:0017053	0.860	transcription repressor complex
GO:0005737	0.806	cytoplasm
GO:0005829	0.411	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	1.000	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	1.000	histone deacetylase.

[back to server]