StarFunc result for job id Q8N109

User Input

>input (375 residues)
MSLMVISMACVGFFLLQGAWTHEGGQDKPLLSAWPSAVVPRGGHVTLLCRSRLGFTIFSL
YKEDGVPVPELYNKIFWKSILMGPVTPAHAGTYRCRGSHPRSPIEWSAPSNPLVIVVTGL
FGKPSLSAQPGPTVRTGENVTLSCSSRSSFDMYHLSREGRAHEPRLPAVPSVNGTFQADF
PLGPATHGGTYTCFGSLHDSPYEWSDPSDPLLVSVTGNSSSSSSSPTEPSSKTGIRRHLH
ILIGTSVAIILFIILFFFLLHCCCSNKKNAAVMDQEPAGDRTVNREDSDDQDPQEVTYAQ
LDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQALRGSSRETTAL
SQNRVASSHVPAAGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43630	0.278	0.230	5.750E-45	455	0.693	0.571	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
2	AFDB:P43629	0.389	0.335	1.460E-43	444	0.701	0.592	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
3	AFDB:P43626	0.538	0.574	5.445E-41	348	0.629	0.678	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
4	AFDB:Q8N743	0.279	0.255	8.442E-41	410	0.651	0.595	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
5	AFDB:P43632	0.485	0.592	1.461E-37	304	0.539	0.664	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
6	AFDB:Q14952	0.501	0.604	6.077E-37	304	0.528	0.651	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
7	AFDB:Q8NHJ6	0.439	0.371	5.757E-25	448	0.317	0.266	Q8NHJ6.pdb.gz	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
8	AFDB:O75023	0.475	0.307	2.032E-24	590	0.328	0.208	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
9	AFDB:Q64281	0.460	0.512	5.757E-24	335	0.251	0.281	Q64281.pdb.gz	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
10	AFDB:A6NI73	0.476	0.590	1.310E-23	299	0.253	0.318	A6NI73.pdb.gz	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
11	PDB:5c6wJ	0.219	0.307	2.507E-6	238	0.075	0.118	5c6wJ.pdb.gz
12	PDB:1ngwH	0.200	0.292	4.106E-5	216	0.096	0.167	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
13	PDB:3bn9F	0.210	0.300	4.338E-5	224	0.093	0.156	3bn9F.pdb.gz
14	PDB:3besR	0.182	0.256	7.105E-5	250	0.043	0.064	3besR.pdb.gz
15	PDB:3o3uN	0.194	0.132	7.928E-5	580	0.077	0.050	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
16	PDB:6jxrm	0.185	0.265	8.375E-5	248	0.101	0.153	6jxrm.pdb.gz
17	PDB:7u7nC	0.180	0.306	9.872E-5	200	0.067	0.125	7u7nC.pdb.gz
18	PDB:1ct8A	0.194	0.309	1.906E-4	214	0.077	0.136	1ct8A.pdb.gz	Diverse structural solutions to catalysis in a family of antibodies.
19	PDB:1e07A	0.195	0.132	2.127E-4	642	0.083	0.048	1e07A.pdb.gz
20	PDB:1aqkL	0.198	0.310	2.373E-4	216	0.088	0.153	1aqkL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99706	0.0	602	377	0.787	0.782	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
2	P43628	7.70e-150	428	341	0.621	0.683	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
3	P43626	1.70e-148	425	348	0.621	0.670	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
4	P43627	1.45e-147	423	348	0.616	0.664	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
5	P43629	1.62e-136	398	444	0.592	0.500	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
6	P43632	5.25e-135	389	304	0.539	0.664	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
7	P43631	9.38e-134	386	304	0.541	0.668	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
8	P43630	1.09e-131	386	455	0.573	0.473	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
9	Q14953	3.00e-130	377	304	0.536	0.661	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
10	Q14954	7.93e-129	374	304	0.528	0.651	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
11	Q14952	1.98e-128	372	304	0.528	0.651	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
12	Q8N743	1.33e-122	362	410	0.523	0.478	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
13	F2VZG2	1.23e-114	337	293	0.488	0.625	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
14	Q14943	4.19e-94	288	382	0.424	0.416	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
15	O75023	1.25e-41	155	590	0.328	0.208	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
16	O75022	1.63e-41	156	631	0.336	0.200	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
17	Q8N423	1.48e-38	147	597	0.336	0.211	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
18	Q8N149	2.74e-36	139	483	0.229	0.178	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
19	Q8N6C8	7.04e-36	137	439	0.232	0.198	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
20	O75019	1.47e-35	137	489	0.237	0.182	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00047 ig	2.3e-17	74.3	Immunoglobulin domain
2	PF13895 Ig_2	2.8e-08	45.3	Immunoglobulin domain
3	PF13927 Ig_3	8.3e-06	37.6	Immunoglobulin domain
4	PF13908 Shisa	10	17.7	Wnt and FGF inhibitory regulator
5	PF15330 SIT	98	14.9	SHP2-interacting transmembrane adaptor protein, SIT
6	PF07686 V-set	0.065	24.8	Immunoglobulin V-set domain
7	PF11669 WBP-1	1.6e+02	14.4	WW domain-binding protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003830222.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008956333.1	0.868	Tyrosine-protein phosphatase non-receptor type 11
2	9597.XP_008971906.1	0.868	Tyrosine-protein phosphatase non-receptor type 6 isoform X1
3	9597.XP_003829677.1	0.857	Killer cell lectin like receptor D1
4	9597.XP_003829672.1	0.825	Killer cell lectin like receptor C1
5	9597.XP_003829675.2	0.825	Killer cell lectin like receptor C4
6	9597.XP_008953228.1	0.825	Killer cell lectin like receptor C2
7	9597.XP_008953230.1	0.825	Killer cell lectin like receptor C3
8	9597.XP_008953850.1	0.811	Putative killer cell immunoglobulin-like receptor-like protein KIR3DX1
9	9597.XP_008953855.1	0.800	Killer cell immunoglobulin-like receptor 2DL3
10	9597.XP_008953864.1	0.800	Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3
11	9597.XP_008960492.1	0.800	Killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2
12	9597.XP_003831654.2	0.693	Belongs to the MHC class I family.
13	9597.XP_008953265.1	0.693	Patr class I histocompatibility antigen, A-2 alpha chain-like isoform X2
14	9597.XP_008953333.1	0.693	Patr class I histocompatibility antigen, CH28 alpha chain isoform X1
15	9597.XP_008953338.1	0.693	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon
16	9597.XP_008953344.1	0.693	Putative HLA class I histocompatibility antigen, alpha chain H
17	9597.XP_008953345.1	0.693	Patr class I histocompatibility antigen, alpha chain G
18	9597.XP_008955201.1	0.693	Belongs to the MHC class I family.
19	9597.XP_008957737.1	0.693	Belongs to the MHC class I family.
20	9597.XP_003816207.1	0.561	TYRO protein tyrosine kinase-binding protein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.975	signaling receptor activity
GO:0005102	0.522	signaling receptor binding
GO:0042287	0.464	MHC protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0002682	0.993	regulation of immune system process
GO:0050896	0.992	response to stimulus
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0002376	0.974	immune system process
GO:0048583	0.961	regulation of response to stimulus
GO:0023052	0.955	signaling
GO:0007154	0.955	cell communication
GO:0007165	0.953	signal transduction
GO:0050776	0.943	regulation of immune response
GO:0002683	0.931	negative regulation of immune system process
GO:0045088	0.922	regulation of innate immune response
GO:0002706	0.912	regulation of lymphocyte mediated immunity
GO:0006952	0.904	defense response
GO:0002684	0.824	positive regulation of immune system process
GO:0048523	0.717	negative regulation of cellular process
GO:0006968	0.697	cellular defense response
GO:0048584	0.677	positive regulation of response to stimulus
GO:0051239	0.622	regulation of multicellular organismal process
GO:0019222	0.512	regulation of metabolic process
GO:0048522	0.459	positive regulation of cellular process
GO:0002698	0.454	negative regulation of immune effector process
GO:0006955	0.415	immune response
GO:0007166	0.346	cell surface receptor signaling pathway
GO:0060255	0.336	regulation of macromolecule metabolic process
GO:0032501	0.325	multicellular organismal process
GO:0050778	0.320	positive regulation of immune response
GO:0050865	0.315	regulation of cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.916	organelle
GO:0043227	0.809	membrane-bounded organelle
GO:0005622	0.708	intracellular anatomical structure
GO:0043229	0.697	intracellular organelle
GO:0043231	0.563	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]