StarFunc result for job id Q8N114

User Input

>input (240 residues)
MTAPVPAPRILLPLLLLLLLTPPPGARGEVCMASRGLSLFPESCPDFCCGTCDDQYCCSD
VLKKFVWSEERCAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLS
VVTIIICFTCSCCCLYKTCRRPRPVVTTTTSTTVVHAPYPQPPSVPPSYPGPSYQGYHTM
PPQPGMPAAPYPMQYPPPYPAQPMGPPAYHETLAGGAAAPYPASQPPYNPAYMDAPKAAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N114	1.000	1.000	2.026E-39	240	1.000	1.000	Q8N114.pdb.gz	SHSA5_HUMAN Protein shisa-5 OS=Homo sapiens OX=9606 GN=SHISA5 PE=1 SV=1
2	AFDB:Q9D7I0	0.271	0.275	3.234E-23	235	0.654	0.668	Q9D7I0.pdb.gz	SHSA5_MOUSE Protein shisa-5 OS=Mus musculus OX=10090 GN=Shisa5 PE=1 SV=1
3	AFDB:Q6UWI4	0.217	0.199	1.159E-3	295	0.221	0.180	Q6UWI4.pdb.gz	SHSA2_HUMAN Protein shisa-2 homolog OS=Homo sapiens OX=9606 GN=SHISA2 PE=1 SV=1
4	AFDB:Q9CZN4	0.159	0.098	5.425E-3	424	0.196	0.111	Q9CZN4.pdb.gz	SHSA9_MOUSE Protein shisa-9 OS=Mus musculus OX=10090 GN=Shisa9 PE=1 SV=2
5	AFDB:Q6ZSJ9	0.163	0.095	8.678E-3	500	0.154	0.074	Q6ZSJ9.pdb.gz	SHSA6_HUMAN Protein shisa-6 OS=Homo sapiens OX=9606 GN=SHISA6 PE=1 SV=2
6	AFDB:Q3UH99	0.190	0.106	1.942E-2	525	0.196	0.090	Q3UH99.pdb.gz	SHSA6_MOUSE Protein shisa-6 OS=Mus musculus OX=10090 GN=Shisa6 PE=1 SV=1
7	AFDB:Q6UWV7	0.175	0.214	2.486E-1	190	0.146	0.184	Q6UWV7.pdb.gz	SHL2A_HUMAN Protein shisa-like-2A OS=Homo sapiens OX=9606 GN=SHISAL2A PE=1 SV=2
8	AFDB:Q5AH63	0.117	0.159	4.864E-1	167	0.129	0.186	Q5AH63.pdb.gz	Q5AH63_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C702370WA PE=4 SV=1
9	AFDB:Q03751	0.162	0.158	5.201E-1	249	0.133	0.129	Q03751.pdb.gz	DNJC5_DROME DnaJ homolog subfamily C member 5 homolog OS=Drosophila melanogaster OX=7227 GN=Csp PE=1 SV=1
10	AFDB:A0A024R906	0.165	0.051	7.780E-1	855	0.129	0.036	A0A024R906.pdb.gz
11	PDB:7s78P	0.181	0.303	6.324	134	0.054	0.097	7s78P.pdb.gz	Structure of a Cell Entry Defective Human Adenovirus Provides Insights into Precursor Proteins and Capsid Maturation.
12	PDB:6v3fA	0.121	0.029	7.734	1234	0.071	0.014	6v3fA.pdb.gz	Cryo-EM structures of NPC1L1 reveal mechanisms of cholesterol transport and ezetimibe inhibition

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N114	1.00e-171	474	240	1.000	1.000	SHSA5_HUMAN Protein shisa-5 OS=Homo sapiens OX=9606 GN=SHISA5 PE=1 SV=1
2	Q9D7I0	1.05e-70	218	235	0.658	0.672	SHSA5_MOUSE Protein shisa-5 OS=Mus musculus OX=10090 GN=Shisa5 PE=1 SV=1
3	Q96DD7	1.66e-08	55.1	197	0.263	0.320	SHSA4_HUMAN Protein shisa-4 OS=Homo sapiens OX=9606 GN=SHISA4 PE=1 SV=3
4	A0A1W2Q6F0	3.50e-04	43.9	1030	0.104	0.024	A0A1W2Q6F0_RAT Transcription elongation factor SPT5 OS=Rattus norvegicus OX=10116 GN=Supt5h PE=1 SV=2
5	Q9DDT5	4.15e-04	43.5	1084	0.117	0.026	SPT5H_DANRE Transcription elongation factor SPT5 OS=Danio rerio OX=7955 GN=supt5h PE=1 SV=1
6	A0A8I5ZR84	5.59e-04	43.1	1163	0.117	0.024	A0A8I5ZR84_RAT Transcription elongation factor SPT5 OS=Rattus norvegicus OX=10116 GN=Supt5h PE=1 SV=1
7	O00267	7.88e-04	42.7	1087	0.117	0.026	SPT5H_HUMAN Transcription elongation factor SPT5 OS=Homo sapiens OX=9606 GN=SUPT5H PE=1 SV=1
8	A0A1W2Q689	8.01e-04	42.7	1079	0.117	0.026	A0A1W2Q689_RAT Transcription elongation factor SPT5 OS=Rattus norvegicus OX=10116 GN=Supt5h PE=1 SV=2
9	A0A8I5ZQE4	8.46e-04	42.7	1083	0.117	0.026	A0A8I5ZQE4_RAT Transcription elongation factor SPT5 OS=Rattus norvegicus OX=10116 GN=Supt5h PE=1 SV=1
10	O55201	8.54e-04	42.7	1082	0.117	0.026	SPT5H_MOUSE Transcription elongation factor SPT5 OS=Mus musculus OX=10090 GN=Supt5h PE=1 SV=1
11	Q2UK72	8.61e-04	42.4	765	0.117	0.037	PABP_ASPOR Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pab1 PE=3 SV=1
12	F1S593	0.013	38.9	868	0.133	0.037	F1S593_PIG dynamin GTPase OS=Sus scrofa OX=9823 GN=DNM2 PE=3 SV=4
13	O14776	0.013	38.9	1098	0.133	0.029	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
14	F4K5Y5	0.027	38.1	1237	0.083	0.016	F4K5Y5_ARATH COP1-interacting protein-like protein OS=Arabidopsis thaliana OX=3702 GN=MNL12.14 PE=1 SV=1
15	P39054	0.031	37.7	870	0.125	0.034	DYN2_MOUSE Dynamin-2 OS=Mus musculus OX=10090 GN=Dnm2 PE=1 SV=2
16	P39052	0.043	37.4	870	0.125	0.034	DYN2_RAT Dynamin-2 OS=Rattus norvegicus OX=10116 GN=Dnm2 PE=1 SV=1
17	Q8BZ98	0.043	37.4	863	0.104	0.029	DYN3_MOUSE Dynamin-3 OS=Mus musculus OX=10090 GN=Dnm3 PE=1 SV=1
18	Q9VB05	0.10	36.2	836	0.142	0.041	Q9VB05_DROME ALG-2 interacting protein X OS=Drosophila melanogaster OX=7227 GN=ALiX PE=1 SV=1
19	Q9VC64	0.14	35.8	1729	0.096	0.013	Q9VC64_DROME Anastral spindle 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ana1 PE=1 SV=1
20	Q9UKF5	0.20	35.4	820	0.138	0.040	ADA29_HUMAN Disintegrin and metalloproteinase domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ADAM29 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13908 Shisa	2e-53	192.9	Wnt and FGF inhibitory regulator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296444

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481203	0.664	Putative protein shisa-8
2	9606.ENSP00000337797	0.563	P53-induced death domain-containing protein 1
3	9606.ENSP00000415430	0.523	G2 and S phase-expressed protein 1
4	9606.ENSP00000457230	0.522	WW domain-containing oxidoreductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050699	1.000	WW domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:1902533	0.962	positive regulation of intracellular signal transduction
GO:0043122	0.927	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043123	0.904	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0009987	0.876	cellular process
GO:0050896	0.627	response to stimulus
GO:0051716	0.382	cellular response to stimulus
GO:0048519	0.312	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	1.000	intracellular organelle lumen
GO:0005783	0.999	endoplasmic reticulum
GO:0031981	0.966	nuclear lumen
GO:0016020	0.895	membrane
GO:0005654	0.873	nucleoplasm
GO:0005788	0.639	endoplasmic reticulum lumen
GO:0005829	0.434	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]