StarFunc result for job id Q8N122

User Input

>input (1335 residues)
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEATELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRNPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYHTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLVSDGSPMVR
KELVVALSHLVVQYESNFCTVALQFIEEEKNYALPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVATARSLNKSLQNLSLTEESGGAVAFSPGNLSTSSSASSTLGSPENEEHILS
FETIDKMRRASSYSSLNSLIGVSFNSVYTQIWRVLLHLAADPYPEVSDVAMKVLNSIAYK
ATVNARPQRVLDTSSLTQSAPASPTNKGVHIHQAGGSPPASSTSSSSLTNDVAKQPVSRD
LPSGRPGTTGPAGAQYTPHSHQFPRTRKMFDKGPEQTADDADDAAGHKSFISATVQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNSRVRRQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKASLQKRPDGHIVSVSVNGDVRIFDPRMPESVNVLQIVKGLTALD
IHPQADLIACGSVNQFTAIYNSSGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6bcuW	0.781	0.989	0.000	1052	0.786	0.997	6bcuW.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
2	PDB:6u62A	0.798	0.958	0.000	1110	0.829	0.997	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.
3	AFDB:D3ZDU2	0.869	0.869	0.000	1335	0.967	0.967	D3ZDU2.pdb.gz	D3ZDU2_RAT Regulatory associated protein of MTOR, complex 1 OS=Rattus norvegicus OX=10116 GN=Rptor PE=1 SV=2
4	AFDB:Q9W437	0.780	0.645	1.465E-102	1621	0.461	0.379	Q9W437.pdb.gz	Q9W437_DROME Raptor, isoform B OS=Drosophila melanogaster OX=7227 GN=raptor PE=1 SV=2
5	AFDB:P87141	0.774	0.787	2.441E-94	1313	0.402	0.409	P87141.pdb.gz	MIP1_SCHPO Target of rapamycin complex 1 subunit mip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mip1 PE=1 SV=1
6	AFDB:Q9LZW9	0.763	0.762	1.675E-92	1336	0.409	0.409	Q9LZW9.pdb.gz	RTOR2_ARATH Regulatory-associated protein of TOR 2 OS=Arabidopsis thaliana OX=3702 GN=RAPTOR2 PE=2 SV=2
7	AFDB:P38873	0.749	0.646	9.400E-82	1557	0.381	0.327	P38873.pdb.gz	KOG1_YEAST Target of rapamycin complex 1 subunit KOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KOG1 PE=1 SV=2
8	PDB:5wbjA	0.736	0.923	3.656E-80	1058	0.381	0.481	5wbjA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
9	AFDB:Q68TI8	0.738	0.554	4.760E-72	1800	0.330	0.245	Q68TI8.pdb.gz	Q68TI8_CAEEL DAF-15 OS=Caenorhabditis elegans OX=6239 GN=daf-15 PE=1 SV=1
10	AFDB:Q387I9	0.631	0.638	1.917E-51	1319	0.222	0.225	Q387I9.pdb.gz	Q387I9_TRYB2 Raptor N-terminal CASPase-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0460 PE=1 SV=1
11	PDB:5h64B	0.127	0.190	7.314E-26	797	0.452	0.758	5h64B.pdb.gz
12	AFDB:Q5ACY4	0.203	0.434	8.115E-12	597	0.073	0.162	Q5ACY4.pdb.gz	Q5ACY4_CANAL Cdh1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDH1 PE=3 SV=1
13	PDB:7zgrD	0.205	0.661	9.992E-12	395	0.041	0.139	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
14	PDB:7mq8LJ	0.202	0.545	1.123E-11	469	0.043	0.124	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5o9zL	0.193	0.528	1.167E-11	459	0.041	0.120	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
16	PDB:5mzhB	0.182	0.526	1.655E-11	415	0.038	0.123	5mzhB.pdb.gz
17	PDB:7vggA	0.199	0.808	2.171E-11	304	0.037	0.161	7vggA.pdb.gz
18	AFDB:O13166	0.210	0.358	2.404E-11	761	0.058	0.101	O13166.pdb.gz	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
19	PDB:6nd4U	0.201	0.611	3.458E-11	407	0.047	0.155	6nd4U.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
20	AFDB:Q09649	0.200	0.366	6.593E-11	702	0.074	0.141	Q09649.pdb.gz	Q09649_CAEEL Anaphase-promoting complex subunit 4 WD40 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fzr-1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6AHQ2	0.0	2533	1327	0.933	0.939	A0A8I6AHQ2_RAT Regulatory associated protein of MTOR, complex 1 OS=Rattus norvegicus OX=10116 GN=Rptor PE=1 SV=1
2	A0A8I6ANV2	0.0	2575	1286	0.931	0.967	A0A8I6ANV2_RAT Regulatory associated protein of MTOR, complex 1 OS=Rattus norvegicus OX=10116 GN=Rptor PE=1 SV=1
3	B7Z3S8	0.0	1735	883	0.634	0.958	B7Z3S8_HUMAN cDNA FLJ52081, highly similar to Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 PE=2 SV=1
4	C3KKC3	0.0	905	1621	0.332	0.273	C3KKC3_DROME MIP06744p OS=Drosophila melanogaster OX=7227 GN=raptor-RA PE=2 SV=1
5	D3ZDU2	0.0	2702	1335	0.968	0.968	D3ZDU2_RAT Regulatory associated protein of MTOR, complex 1 OS=Rattus norvegicus OX=10116 GN=Rptor PE=1 SV=2
6	P87141	0.0	772	1313	0.296	0.301	MIP1_SCHPO Target of rapamycin complex 1 subunit mip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mip1 PE=1 SV=1
7	Q55BR7	0.0	639	1509	0.224	0.198	RPTOR_DICDI Protein raptor homolog OS=Dictyostelium discoideum OX=44689 GN=raptor PE=1 SV=1
8	Q8K4Q0	0.0	2698	1335	0.966	0.966	RPTOR_MOUSE Regulatory-associated protein of mTOR OS=Mus musculus OX=10090 GN=Rptor PE=1 SV=1
9	Q8N122	0.0	2777	1335	1.000	1.000	RPTOR_HUMAN Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1
10	Q9LZW9	0.0	907	1336	0.412	0.412	RTOR2_ARATH Regulatory-associated protein of TOR 2 OS=Arabidopsis thaliana OX=3702 GN=RAPTOR2 PE=2 SV=2
11	Q9W437	0.0	905	1621	0.332	0.273	Q9W437_DROME Raptor, isoform B OS=Drosophila melanogaster OX=7227 GN=raptor PE=1 SV=2
12	Q68TI8	2.77e-137	464	1800	0.188	0.139	Q68TI8_CAEEL DAF-15 OS=Caenorhabditis elegans OX=6239 GN=daf-15 PE=1 SV=1
13	G5EF88	3.08e-137	463	1776	0.188	0.141	G5EF88_CAEEL Raptor N-terminal CASPase-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=daf-15 PE=1 SV=1
14	G5EEV7	3.84e-137	463	1782	0.188	0.141	G5EEV7_CAEEL Raptor N-terminal CASPase-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=daf-15 PE=1 SV=1
15	P38873	1.00e-124	425	1557	0.156	0.134	KOG1_YEAST Target of rapamycin complex 1 subunit KOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KOG1 PE=1 SV=2
16	Q387I9	1.69e-86	311	1319	0.133	0.134	Q387I9_TRYB2 Raptor N-terminal CASPase-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0460 PE=1 SV=1
17	Q93YQ1	9.79e-55	212	1344	0.120	0.119	RTOR1_ARATH Regulatory-associated protein of TOR 1 OS=Arabidopsis thaliana OX=3702 GN=RAPTOR1 PE=1 SV=1
18	Q4GZ02	4.51e-30	132	1747	0.073	0.056	Q4GZ02_TRYB2 Raptor N-terminal CASPase-like domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.2190 PE=4 SV=1
19	Q54KL5	1.13e-08	60.8	335	0.046	0.185	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
20	A0MNP2	3.53e-07	56.2	357	0.055	0.204	A0MNP2_HUMAN CDW11/WDR57 OS=Homo sapiens OX=9606 GN=WDR57 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.52	22.0	Anaphase-promoting complex subunit 4 WD40 domain
2	PF12717 Cnd1	0.0013	30.3	non-SMC mitotic condensation complex subunit 1
3	PF02985 HEAT	1.1e-10	51.8	HEAT repeat
4	PF13646 HEAT_2	3.2e-05	35.6	HEAT repeats
5	PF13513 HEAT_EZ	12	17.8	HEAT-like repeat
6	PF20168 PDS5	1.4e+02	11.7	Sister chromatid cohesion protein PDS5 protein
7	PF00656 Peptidase_C14	2.8e+02	12.9	Caspase domain
8	PF14538 Raptor_N	2.6e-69	243.3	Raptor N-terminal CASPase like domain
9	PF00400 WD40	2.3e-06	39.4	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307272

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225577	0.999	Ribosomal protein S6 kinase beta-1
2	9606.ENSP00000256644	0.999	Ragulator complex protein LAMTOR5
3	9606.ENSP00000262187	0.999	GTP-binding protein Rheb
4	9606.ENSP00000262850	0.999	Ras-related GTP-binding protein B
5	9606.ENSP00000278671	0.999	Ragulator complex protein LAMTOR1
6	9606.ENSP00000286234	0.999	DEP domain-containing mTOR-interacting protein
7	9606.ENSP00000296782	0.999	Rapamycin-insensitive companion of mTOR
8	9606.ENSP00000340691	0.999	Eukaryotic translation initiation factor 4E-binding protein 1
9	9606.ENSP00000343118	0.999	Ragulator complex protein LAMTOR4
10	9606.ENSP00000354558	0.999	Serine/threonine-protein kinase mTOR
11	9606.ENSP00000357288	0.999	Ragulator complex protein LAMTOR2
12	9606.ENSP00000358423	0.999	Ras-related GTP-binding protein D
13	9606.ENSP00000362092	0.999	Ras-related GTP-binding protein C
14	9606.ENSP00000369899	0.999	Ras-related GTP-binding protein A
15	9606.ENSP00000375711	0.999	Proline-rich AKT1 substrate 1
16	9606.ENSP00000456405	0.999	Target of rapamycin complex subunit LST8
17	9606.ENSP00000324560	0.996	Serine/threonine-protein kinase ULK1
18	9606.ENSP00000424183	0.995	Ragulator complex protein LAMTOR3
19	9606.ENSP00000219476	0.994	Tuberin
20	9606.ENSP00000451828	0.994	RAC-alpha serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.995	protein kinase binding
GO:0030234	0.300	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0031323	0.986	regulation of cellular metabolic process
GO:0048522	0.976	positive regulation of cellular process
GO:0051174	0.945	regulation of phosphorus metabolic process
GO:0042325	0.943	regulation of phosphorylation
GO:0042127	0.831	regulation of cell population proliferation
GO:0009987	0.827	cellular process
GO:0050679	0.764	positive regulation of epithelial cell proliferation
GO:0050896	0.761	response to stimulus
GO:0001936	0.748	regulation of endothelial cell proliferation
GO:0001938	0.712	positive regulation of endothelial cell proliferation
GO:0080090	0.556	regulation of primary metabolic process
GO:0060255	0.553	regulation of macromolecule metabolic process
GO:0051716	0.513	cellular response to stimulus
GO:0051171	0.467	regulation of nitrogen compound metabolic process
GO:0051246	0.400	regulation of protein metabolic process
GO:0009893	0.387	positive regulation of metabolic process
GO:0007154	0.384	cell communication
GO:0031325	0.378	positive regulation of cellular metabolic process
GO:0048519	0.359	negative regulation of biological process
GO:0008152	0.347	metabolic process
GO:0023051	0.347	regulation of signaling
GO:0010646	0.339	regulation of cell communication
GO:0048523	0.322	negative regulation of cellular process
GO:0048583	0.308	regulation of response to stimulus
GO:0010604	0.301	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.988	membrane
GO:0005737	0.983	cytoplasm
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005829	0.954	cytosol
GO:0031090	0.883	organelle membrane
GO:0032991	0.806	protein-containing complex
GO:0098588	0.797	bounding membrane of organelle
GO:0005773	0.676	vacuole
GO:0005764	0.671	lysosome
GO:0042995	0.605	cell projection
GO:0120025	0.589	plasma membrane bounded cell projection
GO:0005634	0.511	nucleus
GO:0043005	0.399	neuron projection
GO:0043233	0.385	organelle lumen
GO:0070013	0.381	intracellular organelle lumen
GO:0036477	0.369	somatodendritic compartment
GO:0012505	0.315	endomembrane system
GO:0098852	0.315	lytic vacuole membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]