StarFunc result for job id Q8N131

User Input

>input (208 residues)
MGLGARGAWAALLLGTLQVLALLGAAHESAAMAASANIENSGLPHNSSANSTETLQHVPS
DHTNETSNSTVKPPTSVASDSSNTTVTTMKPTAASNTTTPGMVSTNMTSTTLKSTPKTTS
VSQNTSQISTSTMTVTHNSSVTSAASSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVL
SILYIGCKMYYSRRGIRYRTIDEHDAII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N131	1.000	1.000	4.783E-24	208	1.000	1.000	Q8N131.pdb.gz	PORIM_HUMAN Porimin OS=Homo sapiens OX=9606 GN=TMEM123 PE=1 SV=1
2	AFDB:Q92837	0.149	0.121	9.363E-1	279	0.144	0.108	Q92837.pdb.gz	FRAT1_HUMAN Proto-oncogene FRAT1 OS=Homo sapiens OX=9606 GN=FRAT1 PE=1 SV=3
3	AFDB:Q7SZW8	0.158	0.069	2.054	489	0.154	0.065	Q7SZW8.pdb.gz
4	AFDB:Q9VT37	0.195	0.220	2.054	183	0.240	0.273	Q9VT37.pdb.gz	Q9VT37_DROME GH23431p OS=Drosophila melanogaster OX=7227 GN=vsg PE=2 SV=1
5	AFDB:Q95XN0	0.153	0.051	2.733	728	0.106	0.030	Q95XN0.pdb.gz	Q95XN0_CAEEL LIN-65L OS=Caenorhabditis elegans OX=6239 GN=lin-65 PE=1 SV=2
6	AFDB:Q96F86	0.132	0.067	2.733	508	0.130	0.053	Q96F86.pdb.gz	EDC3_HUMAN Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1
7	AFDB:Q6EPZ6	0.131	0.060	3.636	499	0.111	0.046	Q6EPZ6.pdb.gz	Q6EPZ6_ORYSJ BHLH transcription factor PTF1-like protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os09g0417400 PE=3 SV=1
8	AFDB:Q9LDE1	0.129	0.090	5.995	323	0.120	0.077	Q9LDE1.pdb.gz	MY108_ARATH Transcription factor MYB108 OS=Arabidopsis thaliana OX=3702 GN=MYB108 PE=1 SV=1
9	AFDB:V9GXY5	0.160	0.174	5.995	187	0.106	0.118	V9GXY5.pdb.gz	V9GXY5_MOUSE Reproductive homeobox 3A (Fragment) OS=Mus musculus OX=10090 GN=Rhox3a PE=4 SV=1
10	AFDB:Q84LH8	0.157	0.086	7.977	444	0.120	0.056	Q84LH8.pdb.gz	PIF5_ARATH Transcription factor PIF5 OS=Arabidopsis thaliana OX=3702 GN=PIF5 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N131	4.72e-149	414	208	1.000	1.000	PORIM_HUMAN Porimin OS=Homo sapiens OX=9606 GN=TMEM123 PE=1 SV=1
2	Q9R0L9	1.17e-05	46.6	197	0.139	0.147	MUC24_MOUSE Sialomucin core protein 24 OS=Mus musculus OX=10090 GN=Cd164 PE=1 SV=1
3	Q9QX82	1.80e-05	45.8	195	0.159	0.169	MUC24_RAT Sialomucin core protein 24 OS=Rattus norvegicus OX=10116 GN=Cd164 PE=1 SV=1
4	Q04900	0.001	40.4	197	0.087	0.091	MUC24_HUMAN Sialomucin core protein 24 OS=Homo sapiens OX=9606 GN=CD164 PE=1 SV=2
5	M9PB30	0.002	41.2	22949	0.183	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
6	M9PBZ0	0.002	41.2	22830	0.183	0.002	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9PC41	0.002	41.6	22743	0.183	0.002	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PC45	0.002	40.8	22300	0.183	0.002	M9PC45_DROME Dumpy, isoform T OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9PEI1	0.002	40.8	21657	0.188	0.002	M9PEI1_DROME Dumpy, isoform U OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PHX2	0.002	40.4	262	0.091	0.073	M9PHX2_DROME Visgun, isoform E OS=Drosophila melanogaster OX=7227 GN=vsg PE=3 SV=1
11	M9PB31	0.003	40.4	20404	0.183	0.002	M9PB31_DROME Dumpy, isoform V OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PB32	0.003	40.4	19560	0.183	0.002	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PEH5	0.003	40.4	20710	0.188	0.002	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	M9PBZ4	0.004	40.4	18014	0.183	0.002	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
15	Q9VT37	0.005	38.5	183	0.091	0.104	Q9VT37_DROME GH23431p OS=Drosophila melanogaster OX=7227 GN=vsg PE=2 SV=1
16	Q8I0D8	0.006	38.5	182	0.091	0.104	Q8I0D8_DROME RE67695p OS=Drosophila melanogaster OX=7227 GN=vsg PE=2 SV=1
17	M9NER8	0.009	39.3	15638	0.183	0.002	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PCJ8	0.011	38.9	14825	0.183	0.003	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9NCR4	0.014	38.5	15105	0.183	0.003	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	Q5TZ44	0.017	37.0	167	0.087	0.108	Q5TZ44_DANRE CD164 molecule, sialomucin OS=Danio rerio OX=7955 GN=fb75f06 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07010 Endomucin	51	15.2	Endomucin
2	PF05283 MGC-24	1.3e-05	37.0	Multi-glycosylated core protein 24 (MGC-24), sialomucin
3	PF10428 SOG2	1.1e+02	13.4	RAM signalling pathway protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000381204

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265260	0.665	PEST proteolytic signal-containing nuclear protein
2	9606.ENSP00000302938	0.556	WAP four-disulfide core domain protein 13
3	9606.ENSP00000261654	0.522	Adhesion G-protein coupled receptor D1
4	9606.ENSP00000337081	0.508	Zinc finger protein 112

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0071840	0.955	cellular component organization or biogenesis
GO:0016043	0.952	cellular component organization
GO:0065007	0.945	biological regulation
GO:0008361	0.920	regulation of cell size
GO:0070265	0.908	necrotic cell death
GO:0045793	0.812	positive regulation of cell size
GO:0050789	0.366	regulation of biological process
GO:0050794	0.360	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009897	0.995	external side of plasma membrane
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0005634	0.842	nucleus
GO:0070013	0.754	intracellular organelle lumen
GO:0005737	0.745	cytoplasm
GO:0031981	0.624	nuclear lumen
GO:0012505	0.545	endomembrane system
GO:0005654	0.522	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]