StarFunc result for job id Q8N138

User Input

>input (153 residues)
MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWTLTNLIHNMGM
YIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRKFLTITPIVLYFLTSFYTKYD
QIHFVLNTVSLMSVLIPKLPQLHGVRIFGINKY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1W6	0.968	0.968	2.319E-21	153	1.000	1.000	A0A024R1W6.pdb.gz
2	AFDB:Q921I0	0.994	0.994	2.852E-20	153	0.837	0.837	Q921I0.pdb.gz	ORML1_MOUSE ORM1-like protein 1 OS=Mus musculus OX=10090 GN=Ormdl1 PE=2 SV=1
3	AFDB:Q53FV1	0.969	0.969	7.265E-20	153	0.810	0.810	Q53FV1.pdb.gz	ORML2_HUMAN ORM1-like protein 2 OS=Homo sapiens OX=9606 GN=ORMDL2 PE=1 SV=2
4	PDB:7k0mD	0.945	0.945	2.287E-19	153	1.000	1.000	7k0mD.pdb.gz	Structural insights into the regulation of human serine palmitoyltransferase complexes.
5	AFDB:Q9VP04	0.926	0.920	3.218E-13	154	0.497	0.494	Q9VP04.pdb.gz	ORMDL_DROME ORM1-like protein OS=Drosophila melanogaster OX=7227 GN=ORMDL PE=2 SV=1
6	AFDB:O42901	0.894	0.739	6.228E-11	186	0.418	0.344	O42901.pdb.gz	YBA9_SCHPO Uncharacterized protein C119.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.09c PE=2 SV=3
7	AFDB:Q9C5I0	0.883	0.861	1.383E-9	157	0.405	0.395	Q9C5I0.pdb.gz	Q9C5I0_ARATH ORMDL family protein OS=Arabidopsis thaliana OX=3702 GN=ATORM1 PE=1 SV=1
8	AFDB:Q9FHY3	0.897	0.891	2.376E-9	154	0.399	0.396	Q9FHY3.pdb.gz	Q9FHY3_ARATH At5g42000 OS=Arabidopsis thaliana OX=3702 GN=ATORM2 PE=1 SV=1
9	AFDB:P53224	0.832	0.579	2.400E-8	222	0.327	0.225	P53224.pdb.gz	ORM1_YEAST Protein ORM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM1 PE=1 SV=1
10	AFDB:Q06144	0.789	0.566	7.159E-7	216	0.320	0.227	Q06144.pdb.gz	ORM2_YEAST Protein ORM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM2 PE=1 SV=1
11	AFDB:P97441	0.179	0.091	1.593	388	0.144	0.057	P97441.pdb.gz	ZNT3_MOUSE Probable proton-coupled zinc antiporter SLC30A3 OS=Mus musculus OX=10090 GN=Slc30a3 PE=1 SV=1
12	PDB:4povA	0.215	0.195	4.326	178	0.137	0.118	4povA.pdb.gz	Structure-Based Design of Potent Small-Molecule Binders to the S-Component of the ECF Transporter for Thiamine.
13	PDB:6jbjA	0.184	0.062	4.544	565	0.196	0.053	6jbjA.pdb.gz	Cryo-EM structure of human lysosomal cobalamin exporter ABCD4.
14	PDB:6wvfA	0.234	0.124	5.014	386	0.105	0.041	6wvfA.pdb.gz	Termini restraining of small membrane proteins enables structure determination at near-atomic resolution.
15	PDB:7wnxA	0.248	0.070	5.267	734	0.124	0.026	7wnxA.pdb.gz	Cryo-EM structure of Mycobacterium smegmatis MmpL3 complexed with ST004 in lipid nanodiscs
16	PDB:6co7A	0.170	0.040	6.105	1061	0.078	0.011	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
17	PDB:1g2nA	0.232	0.169	6.737	246	0.111	0.069	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
18	PDB:5mg3D	0.170	0.085	6.737	414	0.163	0.060	5mg3D.pdb.gz
19	PDB:6rreD	0.163	0.083	6.737	427	0.085	0.030	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.
20	PDB:7td1R	0.239	0.158	6.737	293	0.163	0.085	7td1R.pdb.gz	Differential activation mechanisms of lipid GPCRs by lysophosphatidic acid and sphingosine 1-phosphate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N138	2.33e-110	311	153	1.000	1.000	ORML3_HUMAN ORM1-like protein 3 OS=Homo sapiens OX=9606 GN=ORMDL3 PE=1 SV=1
2	Q9CPZ6	8.42e-109	308	153	0.967	0.967	ORML3_MOUSE ORM1-like protein 3 OS=Mus musculus OX=10090 GN=Ormdl3 PE=2 SV=1
3	Q9P0S3	4.75e-98	280	153	0.843	0.843	ORML1_HUMAN ORM1-like protein 1 OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=1
4	Q921I0	5.79e-98	280	153	0.837	0.837	ORML1_MOUSE ORM1-like protein 1 OS=Mus musculus OX=10090 GN=Ormdl1 PE=2 SV=1
5	Q53FV1	2.31e-95	273	153	0.810	0.810	ORML2_HUMAN ORM1-like protein 2 OS=Homo sapiens OX=9606 GN=ORMDL2 PE=1 SV=2
6	J3QRM9	4.34e-92	265	129	0.843	1.000	J3QRM9_HUMAN ORMDL sphingolipid biosynthesis regulator 3 (Fragment) OS=Homo sapiens OX=9606 GN=ORMDL3 PE=1 SV=1
7	F8VXD5	1.99e-71	212	119	0.627	0.807	F8VXD5_HUMAN ORMDL sphingolipid biosynthesis regulator 2 OS=Homo sapiens OX=9606 GN=ORMDL2 PE=1 SV=1
8	A0A1B0GXE7	5.67e-68	203	109	0.601	0.844	A0A1B0GXE7_HUMAN ORMDL sphingolipid biosynthesis regulator 1 OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=1
9	F6WST4	1.98e-67	201	108	0.595	0.843	F6WST4_HUMAN ORMDL sphingolipid biosynthesis regulator 1 (Fragment) OS=Homo sapiens OX=9606 GN=ORMDL1 PE=1 SV=7
10	Q9VP04	1.00e-51	163	154	0.497	0.494	ORMDL_DROME ORM1-like protein OS=Drosophila melanogaster OX=7227 GN=ORMDL PE=2 SV=1
11	O42901	2.38e-35	123	186	0.412	0.339	YBA9_SCHPO Uncharacterized protein C119.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC119.09c PE=2 SV=3
12	Q9C5I0	5.16e-32	113	157	0.405	0.395	Q9C5I0_ARATH ORMDL family protein OS=Arabidopsis thaliana OX=3702 GN=ATORM1 PE=1 SV=1
13	Q9FHY3	1.22e-30	110	154	0.386	0.383	Q9FHY3_ARATH At5g42000 OS=Arabidopsis thaliana OX=3702 GN=ATORM2 PE=1 SV=1
14	P53224	1.06e-19	83.6	222	0.340	0.234	ORM1_YEAST Protein ORM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM1 PE=1 SV=1
15	Q06144	1.73e-19	82.8	216	0.359	0.255	ORM2_YEAST Protein ORM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ORM2 PE=1 SV=1
16	Q7Z4L4	3.2	30.0	538	0.092	0.026	Q7Z4L4_HUMAN TNIK protein OS=Homo sapiens OX=9606 GN=TNIK PE=2 SV=1
17	D3ZZQ0	4.2	30.0	1260	0.092	0.011	D3ZZQ0_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=2
18	Q9UKE5	4.2	30.0	1360	0.092	0.010	TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK PE=1 SV=1
19	A0A0G2K490	4.3	30.0	1360	0.092	0.010	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
20	A0A8I5ZQ07	4.3	30.0	1340	0.092	0.010	A0A8I5ZQ07_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11915 DUF3433	1.3e+02	14.4	Protein of unknown function (DUF3433)
2	PF04061 ORMDL	2.5e-49	178.0	ORMDL family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003831487.2

Rank	PPI partner	STRING score	Description
1	9597.XP_003808428.1	0.716	Serine palmitoyltransferase long chain base subunit 1
2	9597.XP_008955037.1	0.700	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 56 ESTs, 3 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
3	9597.XP_008959851.1	0.679	Serine palmitoyltransferase 1-like
4	9597.XP_008957108.1	0.664	Alpha-1-acid glycoprotein 2
5	9597.XP_003831492.1	0.659	Zona pellucida binding protein 2
6	9597.XP_003823122.1	0.655	DENN domain-containing protein 1B isoform X1
7	9597.XP_003808928.1	0.649	Serine palmitoyltransferase long chain base subunit 2
8	9597.XP_008953394.1	0.645	1-acylglycerol-3-phosphate O-acyltransferase 1
9	9597.XP_003805368.1	0.644	Tyrosine-protein kinase Blk
10	9597.XP_008973579.1	0.636	SP140 nuclear body protein
11	9597.XP_008970523.1	0.634	Transmembrane protein 110
12	9597.XP_003824988.1	0.631	Belongs to the eukaryotic ribosomal protein eS26 family.
13	9597.XP_008966021.1	0.614	Delta 4-desaturase, sphingolipid 1
14	9597.XP_003811016.1	0.603	Belongs to the G-protein coupled receptor 1 family.
15	9597.XP_003823569.1	0.600	Zinc finger protein 804A
16	9597.XP_003831489.1	0.589	Leucine-rich repeat-containing protein 3C
17	9597.XP_008970151.1	0.583	Neuroplastin isoform X1
18	9597.XP_003817012.1	0.580	Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family
19	9597.XP_008952968.1	0.580	Solute carrier family 22 member 5
20	9597.XP_003818647.1	0.579	Belongs to the BI1 family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.995	regulation of biological process
GO:0044087	0.985	regulation of cellular component biogenesis
GO:0034248	0.985	regulation of amide metabolic process
GO:0043603	0.984	amide metabolic process
GO:0046890	0.982	regulation of lipid biosynthetic process
GO:0071704	0.976	organic substance metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0044255	0.968	cellular lipid metabolic process
GO:0006665	0.962	sphingolipid metabolic process
GO:0060255	0.960	regulation of macromolecule metabolic process
GO:0010556	0.927	regulation of macromolecule biosynthetic process
GO:0031326	0.924	regulation of cellular biosynthetic process
GO:0048519	0.845	negative regulation of biological process
GO:0048523	0.844	negative regulation of cellular process
GO:0045833	0.807	negative regulation of lipid metabolic process
GO:0051055	0.785	negative regulation of lipid biosynthetic process
GO:0034249	0.758	negative regulation of amide metabolic process
GO:0031324	0.652	negative regulation of cellular metabolic process
GO:0031327	0.577	negative regulation of cellular biosynthetic process
GO:0048518	0.513	positive regulation of biological process
GO:0048522	0.399	positive regulation of cellular process
GO:0009893	0.392	positive regulation of metabolic process
GO:0006672	0.342	ceramide metabolic process
GO:0008610	0.339	lipid biosynthetic process
GO:0044249	0.322	cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0016020	0.883	membrane
GO:0031090	0.500	organelle membrane
GO:0031984	0.338	organelle subcompartment
GO:0005789	0.332	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]