StarFunc result for job id Q8N139

User Input

>input (1617 residues)
MNMKQKSVYQQTKALLCKNFLKKWRMKRESLLEWGLSILLGLCIALFSSSMRNVQFPGMA
PQNLGRVDKFNSSSLMVVYTPISNLTQQIMNKTALAPLLKGTSVIGAPNKTHMDEILLEN
LPYAMGIIFNETFSYKLIFFQGYNSPLWKEDFSAHCWDGYGEFSCTLTKYWNRGFVALQT
AINTAIIEITTNHPVMEELMSVTAITMKTLPFITKNLLHNEMFILFFLLHFSPLVYFISL
NVTKERKKSKNLMKMMGLQDSAFWLSWGLIYAGFIFIISIFVTIIITFTQIIVMTGFMVI
FILFFLYGLSLVALVFLMSVLLKKAVLTNLVVFLLTLFWGCLGFTVFYEQLPSSLEWILN
ICSPFAFTTGMIQIIKLDYNLNGVIFPDPSGDSYTMIATFSMLLLDGLIYLLLALYFDKI
LPYGDERHYSPLFFLNSSSCFQHQRTNAKVIEKEIDAEHPSDDYFEPVAPEFQGKEAIRI
RNVKKEYKGKSGKVEALKGLLFDIYEGQITAILGHSGAGKSSLLNILNGLSVPTEGSVTI
YNKNLSEMQDLEEIRKITGVCPQFNVQFDILTVKENLSLFAKIKGIHLKEVEQEVQRILL
ELDMQNIQDNLAKHLSEGQKRKLTFGITILGDPQILLLDEPTTGLDPFSRDQVWSLLRER
RADHVILFSTQSMDEADILADRKVIMSNGRLKCAGSSMFLKRRWGLGYHLSLHRNEICNP
EQITSFITHHIPDAKLKTENKEKLVYTLPLERTNTFPDLFSDLDKCSDQGVTGYDISMST
LNEVFMKLEGQSTIEQDFEQVEMIRDSESLNEMELAHSSFSEMQTAVSDMGLWRMQVFAM
ARLRFLKLKRQTKVLLTLLLVFGIAIFPLIVENIMYAMLNEKIDWEFKNELYFLSPGQLP
QEPRTSLLIINNTESNIEDFIKSLKHQNILLEVDDFENRNGTDGLSYNGAIIVSGKQKDY
RFSVVCNTKRLHCFPILMNIISNGLLQMFNHTQHIRIESSPFPLSHIGLWTGLPDGSFFL
FLVLCSISPYITMGSISDYKKNAKSQLWISGLYTSAYWCGQALVDVSFFILILLLMYLIF
YIENMQYLLITSQIVFALVIVTPGYAASLVFFIYMISFIFRKRRKNSGLWSFYFFFASTI
MFSITLINHFDLSILITTMVLVPSYTLLGFKTFLEVRDQEHYREFPEANFELSATDFLVC
FIPYFQTLLFVFVLRCMELKCGKKRMRKDPVFRISPQSRDAKPNPEEPIDEDEDIQTERI
RTATALTTSILDEKPVIIASCLHKEYAGQKKSCFSKRKKKIAARNISFCVQEGEILGLLG
PNGAGKSSSIRMISGITKPTAGEVELKGCSSVLGHLGYCPQENVLWPMLTLREHLEVYAA
VKGLRKADARLAIARLVSAFKLHEQLNVPVQKLTAGITRKLCFVLSLLGNSPVLLLDEPS
TGIDPTGQQQMWQAIQAVVKNTERGVLLTTHNLAEAEALCDRVAIMVSGRLRCIGSIQHL
KNKLGKDYILELKVKETSQVTLVHTEILKLFPQAAGQERYSSLLTYKLPVADVYPLSQTF
HKLEAVKHNFNLEEYSLSQCTLEKVFLELSKEQEVGNFDEEIDTTMRWKLLPHSDEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94911	0.941	0.939	0.000	1621	0.592	0.590	O94911.pdb.gz	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	AFDB:Q8CF82	0.921	0.908	0.000	1642	0.401	0.395	Q8CF82.pdb.gz	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	AFDB:Q8K440	0.947	0.945	0.000	1620	0.552	0.551	Q8K440.pdb.gz	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	AFDB:Q8K449	0.944	0.941	0.000	1623	0.568	0.566	Q8K449.pdb.gz	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
5	AFDB:Q8N139	1.000	1.000	0.000	1617	1.000	1.000	Q8N139.pdb.gz	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
6	AFDB:Q99758	0.777	0.741	1.018E-91	1704	0.259	0.245	Q99758.pdb.gz	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
7	AFDB:E9PWH4	0.775	0.753	2.491E-91	1668	0.250	0.242	E9PWH4.pdb.gz	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
8	AFDB:A0A0G2K1Q8	0.768	0.733	7.545E-91	1704	0.259	0.246	A0A0G2K1Q8.pdb.gz	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
9	AFDB:E9PX95	0.790	0.742	3.499E-90	1733	0.252	0.235	E9PX95.pdb.gz	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1
10	AFDB:Q84M24	0.787	0.684	1.553E-88	1882	0.257	0.221	Q84M24.pdb.gz	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
11	PDB:7w01A	0.772	0.780	2.457E-78	1598	0.250	0.253	7w01A.pdb.gz
12	PDB:7w02A	0.702	0.722	9.608E-78	1566	0.237	0.245	7w02A.pdb.gz	Cryo-EM structures of the human surfactant lipid transporter ABCA3.
13	PDB:7lkzA	0.699	0.599	1.884E-70	1920	0.234	0.197	7lkzA.pdb.gz	Molecular structures of the eukaryotic retinal importer ABCA4.
14	PDB:7tbwA	0.703	0.599	8.718E-68	1928	0.244	0.204	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
15	PDB:7e7qA	0.665	0.560	1.795E-65	1958	0.231	0.191	7e7qA.pdb.gz	Structural basis of substrate recognition and translocation by human ABCA4.
16	PDB:7e7iA	0.666	0.548	5.209E-65	2011	0.229	0.184	7e7iA.pdb.gz
17	PDB:7tbyA	0.654	0.597	1.220E-63	1788	0.224	0.203	7tbyA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
18	PDB:7roqA	0.621	0.554	1.372E-54	1831	0.202	0.178	7roqA.pdb.gz	Structure of the Human Lipid Exporter ABCA1.
19	PDB:7m1pA	0.623	0.530	2.382E-52	1938	0.216	0.181	7m1pA.pdb.gz
20	PDB:7m1qA	0.603	0.519	3.934E-44	1911	0.208	0.176	7m1qA.pdb.gz	Cryo-EM structures of the ABCA4 importer reveal mechanisms underlying substrate binding and Stargardt disease.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O94911	0.0	1848	1621	0.596	0.595	ABCA8_HUMAN ABC-type organic anion transporter ABCA8 OS=Homo sapiens OX=9606 GN=ABCA8 PE=1 SV=4
2	Q8CF82	0.0	1165	1642	0.417	0.410	ABCA5_RAT Cholesterol transporter ABCA5 OS=Rattus norvegicus OX=10116 GN=Abca5 PE=2 SV=1
3	Q8K440	0.0	1694	1620	0.558	0.557	ABC8B_MOUSE ABC-type organic anion transporter ABCA8B OS=Mus musculus OX=10090 GN=Abca8b PE=1 SV=2
4	Q8K448	0.0	1166	1642	0.415	0.409	ABCA5_MOUSE Cholesterol transporter ABCA5 OS=Mus musculus OX=10090 GN=Abca5 PE=1 SV=2
5	Q8K449	0.0	1750	1623	0.573	0.571	ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus OX=10090 GN=Abca9 PE=1 SV=2
6	Q8N139	0.0	3335	1617	1.000	1.000	ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens OX=9606 GN=ABCA6 PE=1 SV=2
7	Q8WWZ7	0.0	1196	1642	0.425	0.419	ABCA5_HUMAN Cholesterol transporter ABCA5 OS=Homo sapiens OX=9606 GN=ABCA5 PE=1 SV=2
8	Q6XBG2	1.93e-144	488	1668	0.257	0.249	Q6XBG2_MOUSE ATP-binding cassette transporter sub-family A member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
9	E9PWH4	5.14e-144	487	1668	0.257	0.249	E9PWH4_MOUSE ATP-binding cassette, sub-family A (ABC1), member 15 OS=Mus musculus OX=10090 GN=Abca15 PE=1 SV=1
10	Q99758	7.50e-144	487	1704	0.278	0.264	ABCA3_HUMAN Phospholipid-transporting ATPase ABCA3 OS=Homo sapiens OX=9606 GN=ABCA3 PE=1 SV=2
11	Q54BT5	1.06e-128	444	1702	0.257	0.244	ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcA3 PE=3 SV=1
12	Q385F7	2.20e-126	437	1738	0.238	0.222	Q385F7_TRYB2 ABC transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3950 PE=4 SV=1
13	Q8T6J2	1.66e-116	407	1662	0.243	0.236	ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum OX=44689 GN=abcA5 PE=3 SV=1
14	C0P274	4.13e-95	343	1758	0.238	0.219	C0P274_CAEEL ABC transporter domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=1
15	P34358	7.66e-94	339	1704	0.239	0.227	CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans OX=6239 GN=ced-7 PE=1 SV=6
16	A0A0G2K1Q8	1.86e-91	331	1704	0.130	0.123	ABCA3_RAT Phospholipid-transporting ATPase ABCA3 OS=Rattus norvegicus OX=10116 GN=Abca3 PE=1 SV=1
17	Q0E8Q7	5.95e-90	326	1597	0.207	0.209	Q0E8Q7_DROME Engulfment ABC transporter in the ovary, isoform B OS=Drosophila melanogaster OX=7227 GN=Eato PE=1 SV=1
18	Q8R420	6.36e-90	327	1704	0.130	0.123	ABCA3_MOUSE Phospholipid-transporting ATPase ABCA3 OS=Mus musculus OX=10090 GN=Abca3 PE=1 SV=3
19	Q84M24	1.06e-81	301	1882	0.137	0.118	AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana OX=3702 GN=ABCA1 PE=2 SV=2
20	E9PX95	3.18e-77	286	1733	0.116	0.108	ABCAH_MOUSE ATP-binding cassette sub-family A member 17 OS=Mus musculus OX=10090 GN=Abca17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	6.1	17.9	AAA ATPase domain
2	PF13191 AAA_16	1.1	21.1	AAA ATPase domain
3	PF13304 AAA_21	1.4e-12	59.6	AAA domain, putative AbiEii toxin, Type IV TA system
4	PF13401 AAA_22	1.5e+02	14.0	AAA domain
5	PF13555 AAA_29	0.4	21.8	P-loop containing region of AAA domain
6	PF13604 AAA_30	6.9e+02	11.3	AAA domain
7	PF12698 ABC2_membrane_3	2.6e-37	140.3	ABC-2 family transporter protein
8	PF00005 ABC_tran	8.7e-54	193.2	ABC transporter
9	PF13732 DUF4162	8.8e+02	12.0	Domain of unknown function (DUF4162)
10	PF01926 MMR_HSR1	63	15.1	50S ribosome-binding GTPase
11	PF03193 RsgA_GTPase	0.00037	31.9	RsgA GTPase
12	PF02463 SMC_N	69	14.3	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284425

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368880	0.907	Forkhead box protein O1
2	9606.ENSP00000385824	0.903	Forkhead box protein O3
3	9606.ENSP00000232892	0.647	Arylacetamide deacetylase
4	9606.ENSP00000362814	0.629	Serine incorporator 2
5	9606.ENSP00000467271	0.550	ATP-binding cassette sub-family A member 8
6	9606.ENSP00000337335	0.536	Solute carrier family 22 member 8
7	9606.ENSP00000468348	0.533	Dual specificity mitogen-activated protein kinase kinase 6
8	9606.ENSP00000411096	0.528	ATP binding cassette subfamily A member 13
9	9606.ENSP00000360216	0.512	DNA nucleotidylexotransferase
10	9606.ENSP00000285238	0.507	Canalicular multispecific organic anion transporter 2
11	9606.ENSP00000353650	0.502	Fatty acid-binding protein 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042626	0.997	ATPase-coupled transmembrane transporter activity
GO:0005488	0.989	binding
GO:0005515	0.961	protein binding
GO:0140359	0.950	ABC-type transporter activity
GO:0042910	0.723	xenobiotic transmembrane transporter activity
GO:0008559	0.640	ABC-type xenobiotic transporter activity
GO:0005319	0.480	lipid transporter activity
GO:0016887	0.308	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0051179	0.983	localization
GO:0032371	0.968	regulation of sterol transport
GO:0032374	0.954	regulation of cholesterol transport
GO:0006810	0.945	transport
GO:0006869	0.940	lipid transport
GO:0008152	0.934	metabolic process
GO:0071704	0.901	organic substance metabolic process
GO:0044238	0.860	primary metabolic process
GO:0015850	0.730	organic hydroxy compound transport
GO:0010874	0.698	regulation of cholesterol efflux
GO:0044237	0.696	cellular metabolic process
GO:0006807	0.686	nitrogen compound metabolic process
GO:0015918	0.529	sterol transport
GO:0048518	0.484	positive regulation of biological process
GO:0055085	0.329	transmembrane transport
GO:1901564	0.309	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.997	endomembrane system
GO:0005886	0.995	plasma membrane
GO:0005654	0.982	nucleoplasm
GO:0031090	0.876	organelle membrane
GO:0098588	0.623	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.997	Translocases.
EC:7.6.2.2	0.640	ABC-type xenobiotic transporter.
RHEA:13065	0.308	ATP + H2O = ADP + H(+) + phosphate

[back to server]