StarFunc result for job id Q8N142

User Input

>input (457 residues)
MSGTRASNDRPPGAGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADII
SRCQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKG
LKDWEKRLIISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGL
RICDLLSDFDEFSSRFKNLAHQHQSMFPTLEIDIEGQLKRLKGFAERIRPMVRDGVYFMY
EALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGDVYGVVKA
YTTRVGIGAFPTEQINEIGGLLQTRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTALA
LTKLDILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWE
DLPPQAQNYIRFVENHVGVAVKWVGVGKSRESMIQLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0R629	0.991	0.991	1.539E-97	457	0.969	0.969	M0R629.pdb.gz	M0R629_RAT Adenylosuccinate synthetase isozyme 1 OS=Rattus norvegicus OX=10116 GN=Adss1 PE=1 SV=1
2	PDB:1j4bA	0.932	0.985	1.499E-84	432	0.912	0.965	1j4bA.pdb.gz
3	AFDB:Q6NSN5	0.936	0.938	1.312E-80	456	0.803	0.805	Q6NSN5.pdb.gz	PURA1_DANRE Adenylosuccinate synthetase isozyme 1 OS=Danio rerio OX=7955 GN=adss1 PE=1 SV=1
4	AFDB:A4Z6H1	0.941	0.943	1.579E-79	456	0.761	0.763	A4Z6H1.pdb.gz	PURA2_PIG Adenylosuccinate synthetase isozyme 2 OS=Sus scrofa OX=9823 GN=ADSS2 PE=2 SV=1
5	PDB:2v40A	0.903	0.985	1.828E-74	419	0.726	0.792	2v40A.pdb.gz	Human Adenylosuccinate Synthetase Isozyme 2 in Complex with Gdp
6	AFDB:P80210	0.918	0.969	2.963E-67	433	0.536	0.566	P80210.pdb.gz	PURA_YEAST Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE12 PE=1 SV=3
7	AFDB:Q6FMU9	0.918	0.971	2.110E-65	432	0.525	0.556	Q6FMU9.pdb.gz	PURA_CANGA Adenylosuccinate synthetase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K05027g PE=3 SV=1
8	AFDB:Q02787	0.908	0.956	1.258E-63	434	0.536	0.565	Q02787.pdb.gz	PURA_SCHPO Adenylosuccinate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade2 PE=1 SV=2
9	AFDB:P21900	0.909	0.973	8.443E-62	427	0.473	0.506	P21900.pdb.gz	PURA_DICDI Adenylosuccinate synthetase OS=Dictyostelium discoideum OX=44689 GN=purA PE=1 SV=1
10	AFDB:Q96529	0.904	0.844	7.560E-61	490	0.468	0.437	Q96529.pdb.gz	PURA_ARATH Adenylosuccinate synthetase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PURA PE=1 SV=1
11	PDB:1dj2A	0.904	0.962	1.304E-57	429	0.460	0.490	1dj2A.pdb.gz	Structures of adenylosuccinate synthetase from Triticum aestivum and Arabidopsis thaliana.
12	AFDB:P0A7D4	0.902	0.953	1.700E-55	432	0.394	0.417	P0A7D4.pdb.gz	PURA_ECOLI Adenylosuccinate synthetase OS=Escherichia coli (strain K12) OX=83333 GN=purA PE=1 SV=2
13	AFDB:Q3JZ68	0.896	0.952	2.154E-55	430	0.414	0.440	Q3JZ68.pdb.gz	PURA_STRA1 Adenylosuccinate synthetase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=purA PE=3 SV=1
14	PDB:1cg0A	0.895	0.948	3.354E-50	431	0.394	0.418	1cg0A.pdb.gz	Mechanistic implications from crystalline complexes of wild-type and mutant adenylosuccinate synthetases from Escherichia coli.
15	PDB:6tnhA	0.595	0.771	5.449E-19	345	0.188	0.249	6tnhA.pdb.gz	A third purine biosynthetic pathway encoded by aminoadenine-based viral DNA genomes.
16	PDB:7odxA	0.572	0.733	2.277E-17	350	0.171	0.223	7odxA.pdb.gz	Characterization of a triad of genes in cyanophage S-2L sufficient to replace adenine by 2-aminoadenine in bacterial DNA.
17	PDB:6flfA	0.526	0.769	6.233E-17	305	0.162	0.243	6flfA.pdb.gz
18	PDB:2q9cA	0.178	0.254	1.120E-2	304	0.092	0.138	2q9cA.pdb.gz	X-ray Structures of the Signal Recognition Particle Receptor Reveal Targeting Cycle Intermediates.
19	PDB:7mtsC	0.100	0.159	8.395E-2	207	0.039	0.087	7mtsC.pdb.gz	G-protein activation by a metabotropic glutamate receptor.
20	PDB:2wkpA	0.119	0.151	1.198E-1	320	0.070	0.100	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A7H6	0.0	798	431	0.834	0.884	A0A8I6A7H6_RAT Adenylosuccinate synthetase OS=Rattus norvegicus OX=10116 GN=Adss1 PE=1 SV=1
2	A0A8I6AT75	0.0	654	452	0.705	0.712	A0A8I6AT75_RAT Adenylosuccinate synthetase isozyme 2 OS=Rattus norvegicus OX=10116 GN=Adss PE=1 SV=1
3	A0A8I6G9X7	0.0	795	460	0.860	0.854	A0A8I6G9X7_RAT Adenylosuccinate synthetase OS=Rattus norvegicus OX=10116 GN=Adss1 PE=1 SV=1
4	A4Z6H1	0.0	729	456	0.764	0.765	PURA2_PIG Adenylosuccinate synthetase isozyme 2 OS=Sus scrofa OX=9823 GN=ADSS2 PE=2 SV=1
5	D4AEP0	0.0	729	456	0.764	0.765	D4AEP0_RAT Adenylosuccinate synthetase isozyme 2 OS=Rattus norvegicus OX=10116 GN=Adss PE=1 SV=1
6	M0R629	0.0	923	457	0.969	0.969	M0R629_RAT Adenylosuccinate synthetase isozyme 1 OS=Rattus norvegicus OX=10116 GN=Adss1 PE=1 SV=1
7	P28650	0.0	923	457	0.967	0.967	PURA1_MOUSE Adenylosuccinate synthetase isozyme 1 OS=Mus musculus OX=10090 GN=Adss1 PE=1 SV=2
8	P30520	0.0	726	456	0.759	0.761	PURA2_HUMAN Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS2 PE=1 SV=3
9	P46664	0.0	728	456	0.761	0.763	PURA2_MOUSE Adenylosuccinate synthetase isozyme 2 OS=Mus musculus OX=10090 GN=Adss2 PE=1 SV=2
10	P80210	0.0	515	433	0.536	0.566	PURA_YEAST Adenylosuccinate synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ADE12 PE=1 SV=3
11	Q6NSN5	0.0	771	456	0.796	0.798	PURA1_DANRE Adenylosuccinate synthetase isozyme 1 OS=Danio rerio OX=7955 GN=adss1 PE=1 SV=1
12	Q8N142	0.0	942	457	1.000	1.000	PURA1_HUMAN Adenylosuccinate synthetase isozyme 1 OS=Homo sapiens OX=9606 GN=ADSS1 PE=1 SV=1
13	Q02787	2.82e-179	510	434	0.536	0.565	PURA_SCHPO Adenylosuccinate synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ade2 PE=1 SV=2
14	Q6FMU9	2.19e-176	503	432	0.525	0.556	PURA_CANGA Adenylosuccinate synthetase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K05027g PE=3 SV=1
15	P21900	5.15e-158	456	427	0.473	0.506	PURA_DICDI Adenylosuccinate synthetase OS=Dictyostelium discoideum OX=44689 GN=purA PE=1 SV=1
16	Q96529	3.11e-144	423	490	0.464	0.433	PURA_ARATH Adenylosuccinate synthetase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PURA PE=1 SV=1
17	P65887	3.73e-123	367	428	0.425	0.453	PURA_STRPN Adenylosuccinate synthetase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=purA PE=1 SV=1
18	Q3JZ68	1.62e-120	360	430	0.420	0.447	PURA_STRA1 Adenylosuccinate synthetase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) OX=205921 GN=purA PE=3 SV=1
19	A0A8I6G7N1	1.76e-109	324	226	0.354	0.717	A0A8I6G7N1_RAT Adenylosuccinate synthetase OS=Rattus norvegicus OX=10116 GN=Adss PE=1 SV=1
20	A0A8I6GA01	5.06e-108	326	362	0.359	0.453	A0A8I6GA01_RAT Adenylosuccinate synthetase OS=Rattus norvegicus OX=10116 GN=Adss PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00709 Adenylsucc_synt	1.4e-189	641.7	Adenylosuccinate synthetase
2	PF17514 DUF5442	6.5e+02	11.9	Family of unknown function (DUF5442)
3	PF08523 MBF1	5.2e+02	12.5	Multiprotein bridging factor 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000007034

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000013221	0.998	Adenylosuccinate lyase
2	9601.ENSPPYP00000014690	0.996	Bifunctional enzyme that catalyzes 2 steps in purine biosynthesis
3	9601.ENSPPYP00000023211	0.992	Hypoxanthine phosphoribosyltransferase 1
4	9601.ENSPPYP00000020165	0.967	Inosine-5'-monophosphate dehydrogenase
5	9601.ENSPPYP00000015531	0.963	Inosine-5'-monophosphate dehydrogenase
6	9601.ENSPPYP00000018176	0.960	GMP reductase
7	9601.ENSPPYP00000012088	0.953	Inosine triphosphate pyrophosphatase
8	9601.ENSPPYP00000001238	0.944	AMP deaminase
9	9601.ENSPPYP00000001164	0.940	AMP deaminase
10	9601.ENSPPYP00000020661	0.940	Ectonucleoside triphosphate diphosphohydrolase 4
11	9601.ENSPPYP00000014025	0.937	Carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
12	9601.ENSPPYP00000022070	0.932	Argininosuccinate synthase
13	9601.ENSPPYP00000008377	0.927	Aspartate aminotransferase, mitochondrial
14	9601.ENSPPYP00000020754	0.921	Glutamic-oxaloacetic transaminase 1-like 1
15	9601.ENSPPYP00000019942	0.920	Pongo abelii asparagine synthetase (glutamine-hydrolyzing) (ASNS), mRNA
16	9601.ENSPPYP00000000054	0.906	Adenylosuccinate synthetase isozyme 2
17	9601.ENSPPYP00000002915	0.904	Ectonucleoside triphosphate diphosphohydrolase 1
18	9601.ENSPPYP00000015648	0.904	Ectonucleoside triphosphate diphosphohydrolase 3
19	9601.ENSPPYP00000022232	0.904	Ectonucleoside triphosphate diphosphohydrolase 8
20	9601.ENSPPYP00000003658	0.901	Asparaginase like 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0004019	0.999	adenylosuccinate synthase activity
GO:0005515	0.992	protein binding
GO:1901363	0.987	heterocyclic compound binding
GO:0097159	0.987	organic cyclic compound binding
GO:0016787	0.804	hydrolase activity
GO:0000166	0.692	nucleotide binding
GO:0097367	0.690	carbohydrate derivative binding
GO:0032555	0.681	purine ribonucleotide binding
GO:0043168	0.677	anion binding
GO:0035639	0.400	purine ribonucleoside triphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.997	organonitrogen compound metabolic process
GO:1901362	0.996	organic cyclic compound biosynthetic process
GO:0044271	0.996	cellular nitrogen compound biosynthetic process
GO:0006753	0.996	nucleoside phosphate metabolic process
GO:0018130	0.995	heterocycle biosynthetic process
GO:0006163	0.993	purine nucleotide metabolic process
GO:0009168	0.985	purine ribonucleoside monophosphate biosynthetic process
GO:1901135	0.982	carbohydrate derivative metabolic process
GO:0009150	0.963	purine ribonucleotide metabolic process
GO:1901566	0.958	organonitrogen compound biosynthetic process
GO:0019752	0.849	carboxylic acid metabolic process
GO:1901605	0.791	alpha-amino acid metabolic process
GO:0006541	0.723	glutamine metabolic process
GO:0072522	0.608	purine-containing compound biosynthetic process
GO:0006164	0.575	purine nucleotide biosynthetic process
GO:0046033	0.550	AMP metabolic process
GO:0009260	0.496	ribonucleotide biosynthetic process
GO:0009152	0.482	purine ribonucleotide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005829	0.993	cytosol
GO:0043227	0.841	membrane-bounded organelle
GO:0043229	0.738	intracellular organelle
GO:0043231	0.642	intracellular membrane-bounded organelle
GO:0031981	0.538	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15753	0.999	GTP + IMP + L-aspartate = GDP + 2 H(+) + N(6)-(1,2-dicarboxyethyl)-AMP + phosphate
EC:6.3.4.4	0.999	adenylosuccinate synthase.
EC:3.-.-.-	0.804	Hydrolases.

[back to server]