StarFunc result for job id Q8N149

User Input

>input (483 residues)
MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHL
YRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAY
SKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIF
SVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESL
TLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHN
LSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGA
GHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSEA
AETLSPSQNKTDSTTTSLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDA
AGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N149	1.000	1.000	8.202E-97	483	1.000	1.000	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
2	AFDB:O75019	0.784	0.774	4.360E-73	489	0.799	0.789	O75019.pdb.gz	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
3	AFDB:Q8N423	0.803	0.653	6.210E-69	598	0.727	0.587	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
4	AFDB:Q8N6C8	0.805	0.882	1.159E-68	439	0.735	0.809	Q8N6C8.pdb.gz	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
5	AFDB:Q8NHL6	0.776	0.586	7.807E-67	650	0.733	0.545	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
6	AFDB:P59901	0.648	0.631	2.208E-66	499	0.650	0.629	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
7	AFDB:O75022	0.779	0.605	1.253E-63	631	0.621	0.475	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
8	AFDB:O75023	0.779	0.642	1.002E-62	590	0.586	0.480	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
9	AFDB:P97484	0.719	0.429	2.077E-52	841	0.458	0.263	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	AFDB:P43630	0.523	0.553	1.276E-34	455	0.282	0.299	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
11	PDB:5oj2B	0.170	0.127	4.737E-11	692	0.139	0.097	5oj2B.pdb.gz
12	PDB:1e07A	0.177	0.143	7.966E-11	642	0.135	0.101	1e07A.pdb.gz
13	PDB:7q1yA	0.164	0.072	1.928E-10	1374	0.110	0.039	7q1yA.pdb.gz
14	PDB:1igaA	0.187	0.190	8.703E-10	475	0.133	0.135	1igaA.pdb.gz
15	PDB:1hzhH	0.187	0.195	1.624E-9	457	0.135	0.142	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
16	PDB:4rtdA	0.153	0.079	3.730E-9	1122	0.106	0.045	4rtdA.pdb.gz
17	PDB:7q5zA	0.169	0.073	4.837E-9	1344	0.108	0.039	7q5zA.pdb.gz
18	PDB:1igtB	0.185	0.198	6.608E-9	444	0.124	0.135	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
19	PDB:7vonA	0.178	0.078	1.233E-8	1399	0.114	0.039	7vonA.pdb.gz
20	PDB:1zvoC	0.192	0.186	3.142E-8	512	0.122	0.115	1zvoC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75019	0.0	721	489	0.803	0.793	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
2	O75022	0.0	563	631	0.602	0.461	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	P59901	0.0	560	499	0.650	0.629	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
4	Q8N149	0.0	984	483	0.998	0.998	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
5	Q8N423	0.0	656	597	0.718	0.581	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
6	Q8N6C8	0.0	696	439	0.737	0.811	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
7	Q8NHL6	0.0	667	650	0.704	0.523	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
8	O75023	1.93e-175	507	590	0.576	0.471	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
9	P97484	8.99e-127	390	841	0.437	0.251	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	Q8K4V6	2.49e-123	377	697	0.435	0.301	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
11	A6NI73	8.40e-76	242	299	0.267	0.431	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
12	Q8N743	1.28e-63	214	410	0.280	0.329	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
13	Q8NHJ6	1.06e-61	209	448	0.257	0.277	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
14	P43630	4.38e-61	208	455	0.275	0.292	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
15	P43629	1.22e-59	204	444	0.265	0.288	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
16	Q14943	1.04e-58	200	382	0.267	0.338	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
17	Q28109	1.37e-55	188	264	0.251	0.458	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
18	Q64281	3.50e-51	179	335	0.213	0.307	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
19	Q925N6	1.86e-50	187	1320	0.325	0.119	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1
20	Q8N6C5	2.28e-50	187	1336	0.298	0.108	IGSF1_HUMAN Immunoglobulin superfamily member 1 OS=Homo sapiens OX=9606 GN=IGSF1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	58	14.9	Adenovirus E3 region protein CR1
2	PF07679 I-set	11	17.5	Immunoglobulin I-set domain
3	PF00047 ig	2.7e-17	74.1	Immunoglobulin domain
4	PF13895 Ig_2	4.1e-26	102.4	Immunoglobulin domain
5	PF13927 Ig_3	1.6e-23	94.4	Immunoglobulin domain
6	PF16680 Ig_4	5	19.1	T-cell surface glycoprotein CD3 delta chain
7	PF16706 Izumo-Ig	70	14.8	Izumo-like Immunoglobulin domain
8	PF06328 Lep_receptor_Ig	2e+02	13.4	Ig-like C2-type domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251377

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000289902	0.912	High affinity immunoglobulin epsilon receptor subunit gamma
2	9606.ENSP00000358165	0.864	High affinity immunoglobulin gamma Fc receptor I
3	9606.ENSP00000433642	0.858	Low affinity immunoglobulin gamma Fc region receptor III-B
4	9606.ENSP00000351497	0.848	Low affinity immunoglobulin gamma Fc region receptor II-b
5	9606.ENSP00000356946	0.848	Low affinity immunoglobulin gamma Fc region receptor III-A
6	9606.ENSP00000329507	0.839	CMRF35-like molecule 6
7	9606.ENSP00000271450	0.832	Low affinity immunoglobulin gamma Fc region receptor II-a
8	9606.ENSP00000391592	0.829	Tyrosine-protein phosphatase non-receptor type 6
9	9606.ENSP00000412927	0.745	HLA class I histocompatibility antigen, alpha chain G
10	9606.ENSP00000365402	0.679	HLA class I histocompatibility antigen, Cw-7 alpha chain
11	9606.ENSP00000364907	0.677	Tyrosine-protein kinase SYK
12	9606.ENSP00000259951	0.674	HLA class I histocompatibility antigen, alpha chain F
13	9606.ENSP00000379873	0.671	HLA class I histocompatibility antigen, A-3 alpha chain
14	9606.ENSP00000365817	0.666	HLA class I histocompatibility antigen, alpha chain E
15	9606.ENSP00000399168	0.656	HLA class I histocompatibility antigen, B-7 alpha chain
16	9606.ENSP00000452780	0.629	Beta-2-microglobulin
17	9606.ENSP00000303276	0.576	Non-secretory ribonuclease
18	9606.ENSP00000262629	0.549	TYRO protein tyrosine kinase-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0003823	0.945	antigen binding
GO:0004888	0.655	transmembrane signaling receptor activity
GO:0044877	0.589	protein-containing complex binding
GO:0019865	0.437	immunoglobulin binding
GO:0005102	0.324	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.994	response to stimulus
GO:0009987	0.994	cellular process
GO:0050794	0.990	regulation of cellular process
GO:0007154	0.984	cell communication
GO:0048583	0.984	regulation of response to stimulus
GO:0023052	0.983	signaling
GO:0006950	0.983	response to stress
GO:0051716	0.983	cellular response to stimulus
GO:0002682	0.981	regulation of immune system process
GO:0051239	0.980	regulation of multicellular organismal process
GO:0019222	0.966	regulation of metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0007165	0.962	signal transduction
GO:0006952	0.939	defense response
GO:0002768	0.936	immune response-regulating cell surface receptor signaling pathway
GO:0048518	0.924	positive regulation of biological process
GO:0002831	0.921	regulation of response to biotic stimulus
GO:0048519	0.909	negative regulation of biological process
GO:0001817	0.903	regulation of cytokine production
GO:0002376	0.897	immune system process
GO:0032101	0.888	regulation of response to external stimulus
GO:0045088	0.881	regulation of innate immune response
GO:0001819	0.874	positive regulation of cytokine production
GO:0048523	0.856	negative regulation of cellular process
GO:0032680	0.850	regulation of tumor necrosis factor production
GO:0002683	0.772	negative regulation of immune system process
GO:0009966	0.734	regulation of signal transduction
GO:0032501	0.729	multicellular organismal process
GO:0048522	0.716	positive regulation of cellular process
GO:0002684	0.713	positive regulation of immune system process
GO:0006955	0.704	immune response
GO:0050778	0.586	positive regulation of immune response
GO:0001775	0.548	cell activation
GO:0050865	0.541	regulation of cell activation
GO:0002252	0.538	immune effector process
GO:0032102	0.502	negative regulation of response to external stimulus
GO:0045321	0.494	leukocyte activation
GO:0050867	0.471	positive regulation of cell activation
GO:0062207	0.427	regulation of pattern recognition receptor signaling pathway
GO:0009605	0.406	response to external stimulus
GO:0009607	0.402	response to biotic stimulus
GO:0044419	0.399	biological process involved in interspecies interaction between organisms
GO:0051707	0.378	response to other organism
GO:0051249	0.351	regulation of lymphocyte activation
GO:0051241	0.316	negative regulation of multicellular organismal process
GO:0002832	0.301	negative regulation of response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.929	organelle
GO:0043227	0.920	membrane-bounded organelle
GO:0005622	0.911	intracellular anatomical structure
GO:0012505	0.909	endomembrane system
GO:0005737	0.904	cytoplasm
GO:0043231	0.851	intracellular membrane-bounded organelle
GO:0031982	0.822	vesicle
GO:0031410	0.793	cytoplasmic vesicle
GO:0031090	0.695	organelle membrane
GO:0030659	0.690	cytoplasmic vesicle membrane
GO:0098588	0.685	bounding membrane of organelle
GO:0032991	0.624	protein-containing complex
GO:0030667	0.566	secretory granule membrane
GO:0070820	0.550	tertiary granule
GO:0098797	0.345	plasma membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]