StarFunc result for job id Q8N157

User Input

>input (1196 residues)
MPTAESEAKVKTKVRFEELLKTHSDLMREKKKLKKKLVRSEENISPDTIRSNLHYMKETT
SDDPDTIRSNLPHIKETTSDDVSAANTNNLKKSTRVTKNKLRNTQLATENPNGDASVEED
KQGKPNKKVIKTVPQLTTQDLKPETPENKVDSTHQKTHTKPQPGVDHQKSEKANEGREET
DLEEDEELMQAYQCHVTEEMAKEIKRKIRKKLKEQLTYFPSDTLFHDDKLSSEKRKKKKE
VPVFSKAETSTLTISGDTVEGEQKKESSVRSVSSDSHQDDEISSMEQSTEDSMQDDTKPK
PKKTKKKTKAVADNNEDVDGDGVHEITSRDSPVYPKCLLDDDLVLGVYIHRTDRLKSDFM
ISHPMVKIHVVDEHTGQYVKKDDSGRPVSSYYEKENVDYILPIMTQPYDFKQLKSRLPEW
EEQIVFNENFPYLLRGSDESPKVILFFEILDFLSVDEIKNNSEVQNQECGFRKIAWAFLK
LLGANGNANINSKLRLQLYYPPTKPRSPLSVVEAFEWWSKCPRNHYPSTLYVTVRGLKVP
DCIKPSYRSMMALQEEKGKPVHCERHHESSSVDTEPGLEESKEVIKWKRLPGQACRIPNK
HLFSLNAGERGCFCLDFSHNGRILAAACASRDGYPIILYEIPSGRFMRELCGHLNIIYDL
SWSKDDHYILTSSSDGTARIWKNEINNTNTFRVLPHPSFVYTAKFHPAVRELVVTGCYDS
MIRIWKVEMREDSAILVRQFDVHKSFINSLCFDTEGHHMYSGDCTGVIVVWNTYVKINDL
EHSVHHWTINKEIKETEFKGIPISYLEIHPNGKRLLIHTKDSTLRIMDLRILVARKFVGA
ANYREKIHSTLTPCGTFLFAGSEDGIVYVWNPETGEQVAMYSDLPFKSPIRDISYHPFEN
MVAFCAFGQNEPILLYIYDFHVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGS
FQIDEFVHTESSSTKMQLVKQRLETVTEVIRSCAAKVNKNLSFTSPPAVSSQQSKLKQSN
MLTAQEILHQFGFTQTGIISIERKPCNHQVDTAPTVVALYDYTANRSDELTIHRGDIIRV
FFKDNEDWWYGSIGKGQEGYFPANHVASETLYQELPPEIKERSPPLSPEEKTKIEKSPAP
QKQSINKNKSQDFRLGSESMTHSEMRKEQSHEDQGHIMDTRMRKNKQAGRKVTLIE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N157	0.999	0.999	0.000	1196	1.000	1.000	Q8N157.pdb.gz	AHI1_HUMAN Jouberin OS=Homo sapiens OX=9606 GN=AHI1 PE=1 SV=1
2	PDB:2h9lA	0.244	0.873	6.678E-25	321	0.070	0.262	2h9lA.pdb.gz
3	PDB:6id0W	0.252	0.572	1.174E-19	509	0.065	0.153	6id0W.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
4	PDB:5o9zL	0.232	0.580	1.942E-19	459	0.051	0.133	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
5	PDB:5yzgW	0.238	0.626	3.377E-19	440	0.061	0.166	5yzgW.pdb.gz	Structure of a human catalytic step I spliceosome
6	PDB:5mqfF	0.233	0.855	2.795E-18	307	0.062	0.241	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
7	PDB:3zwlD	0.223	0.703	1.892E-17	352	0.048	0.162	3zwlD.pdb.gz
8	PDB:6bk8M	0.237	0.836	2.691E-17	326	0.052	0.190	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
9	PDB:3jb9L	0.230	0.895	4.024E-17	293	0.055	0.225	3jb9L.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
10	PDB:5jcsq	0.215	0.484	4.680E-17	488	0.049	0.121	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
11	PDB:7a5pz	0.221	0.550	4.922E-17	460	0.040	0.104	7a5pz.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
12	AFDB:Q9C0J8	0.226	0.203	7.885E-17	1336	0.081	0.073	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
13	AFDB:H0YL70	0.231	0.346	1.855E-16	782	0.087	0.133	H0YL70.pdb.gz	H0YL70_HUMAN TLE family member 3, transcriptional corepressor OS=Homo sapiens OX=9606 GN=TLE3 PE=1 SV=1
14	AFDB:F4KB17	0.230	0.320	2.076E-15	839	0.095	0.136	F4KB17.pdb.gz	KTN83_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.3 OS=Arabidopsis thaliana OX=3702 GN=KTN80.3 PE=1 SV=1
15	AFDB:F4HTH8	0.223	0.226	2.808E-15	1181	0.092	0.093	F4HTH8.pdb.gz	KTN82_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2 OS=Arabidopsis thaliana OX=3702 GN=KTN80.2 PE=1 SV=1
16	AFDB:Q8H0T9	0.231	0.322	1.093E-14	837	0.074	0.106	Q8H0T9.pdb.gz	KTN84_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 OS=Arabidopsis thaliana OX=3702 GN=KTN80.4 PE=1 SV=3
17	AFDB:Q9H2Y7	0.216	0.141	1.149E-14	1883	0.112	0.071	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
18	AFDB:O13166	0.231	0.356	7.032E-14	761	0.092	0.145	O13166.pdb.gz	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
19	AFDB:Q3U0P1	0.201	0.215	1.875E-11	1104	0.102	0.111	Q3U0P1.pdb.gz	PALB2_MOUSE Partner and localizer of BRCA2 OS=Mus musculus OX=10090 GN=Palb2 PE=1 SV=2
20	AFDB:M9PBJ7	0.203	0.201	4.877E-11	1213	0.083	0.082	M9PBJ7.pdb.gz	M9PBJ7_DROME Misshapen, isoform H OS=Drosophila melanogaster OX=7227 GN=msn PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QX08	0.0	890	1190	0.365	0.367	F1QX08_DANRE Abelson helper integration site 1 OS=Danio rerio OX=7955 GN=ahi1 PE=4 SV=2
2	Q6DTM3	0.0	1675	1047	0.692	0.791	AHI1_RAT Jouberin OS=Rattus norvegicus OX=10116 GN=Ahi1 PE=1 SV=1
3	Q8K3E5	0.0	1679	1047	0.698	0.798	AHI1_MOUSE Jouberin OS=Mus musculus OX=10090 GN=Ahi1 PE=1 SV=2
4	Q8N157	0.0	2500	1196	1.000	1.000	AHI1_HUMAN Jouberin OS=Homo sapiens OX=9606 GN=AHI1 PE=1 SV=1
5	Q54KL5	1.03e-27	117	335	0.074	0.266	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
6	P61964	4.39e-27	115	334	0.070	0.251	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
7	P61965	4.39e-27	115	334	0.070	0.251	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1
8	Q498M4	4.39e-27	115	334	0.070	0.251	WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Wdr5 PE=1 SV=1
9	Q7ZTX2	7.05e-26	112	334	0.069	0.249	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
10	Q4V8C4	7.52e-26	112	328	0.069	0.250	WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus OX=10116 GN=Wdr5b PE=2 SV=1
11	Q9V3J8	2.78e-25	111	361	0.069	0.230	WDS_DROME Protein will die slowly OS=Drosophila melanogaster OX=7227 GN=wds PE=1 SV=1
12	Q9M2Z2	4.17e-24	106	317	0.067	0.252	WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana OX=3702 GN=WDR5A PE=1 SV=1
13	Q17963	8.05e-23	104	376	0.064	0.202	WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.1 PE=1 SV=1
14	Q5JSH3	8.70e-20	98.2	913	0.069	0.090	WDR44_HUMAN WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1
15	H7BY83	1.10e-19	97.8	806	0.069	0.102	H7BY83_HUMAN WD repeat-containing protein 44 (Fragment) OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1
16	Q9R037	2.20e-19	97.1	908	0.061	0.080	WDR44_RAT WD repeat-containing protein 44 OS=Rattus norvegicus OX=10116 GN=Wdr44 PE=1 SV=1
17	Q23256	1.09e-18	93.2	501	0.058	0.138	WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans OX=6239 GN=wdr-5.3 PE=3 SV=1
18	O15736	5.55e-18	91.7	612	0.059	0.116	TIPD_DICDI Protein tipD OS=Dictyostelium discoideum OX=44689 GN=tipD PE=3 SV=1
19	Q6LA54	5.40e-17	89.4	933	0.058	0.074	YF48_SCHPO Uncharacterized WD repeat-containing protein C3H5.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3H5.08c PE=1 SV=2
20	A0MNP2	2.95e-15	81.3	357	0.078	0.261	A0MNP2_HUMAN CDW11/WDR57 OS=Homo sapiens OX=9606 GN=WDR57 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.00022	32.8	Anaphase-promoting complex subunit 4 WD40 domain
2	PF20426 NBCH_WD40	0.27	21.6	Neurobeachin beta propeller domain
3	PF00018 SH3_1	1.3e-12	58.4	SH3 domain
4	PF07653 SH3_2	4.9e-09	47.2	Variant SH3 domain
5	PF14604 SH3_9	4.6e-10	50.6	Variant SH3 domain
6	PF15505 Vexin	3.3e+02	13.5	Vexin domain
7	PF00400 WD40	2.3e-16	71.1	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356774

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000403465	0.990	Coiled-coil and C2 domain-containing protein 2A
2	9606.ENSP00000448012	0.987	Centrosomal protein of 290 kDa
3	9606.ENSP00000389998	0.985	Meckelin
4	9606.ENSP00000313169	0.977	Nephrocystin-1
5	9606.ENSP00000261499	0.966	B9 domain-containing protein 1
6	9606.ENSP00000440638	0.956	Transmembrane protein 216
7	9606.ENSP00000243578	0.955	B9 domain-containing protein 2
8	9606.ENSP00000380779	0.955	Tectonic-1
9	9606.ENSP00000376827	0.952	Meckel syndrome type 1 protein
10	9606.ENSP00000334002	0.951	Huntingtin-associated protein 1
11	9606.ENSP00000304941	0.945	Tectonic-2
12	9606.ENSP00000300935	0.943	Ras-related protein Rab-8A
13	9606.ENSP00000258173	0.930	Transmembrane protein 231
14	9606.ENSP00000369257	0.929	Protein fantom
15	9606.ENSP00000483364	0.928	Tectonic-3
16	9606.ENSP00000373905	0.877	Dynamin-2
17	9606.ENSP00000371067	0.876	Tyrosine-protein kinase JAK2
18	9606.ENSP00000335094	0.867	Transmembrane protein 17
19	9606.ENSP00000314116	0.824	Transmembrane protein 107
20	9606.ENSP00000367398	0.813	Nephrocystin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0048513	0.988	animal organ development
GO:0048731	0.987	system development
GO:0016043	0.982	cellular component organization
GO:0050789	0.980	regulation of biological process
GO:0120036	0.959	plasma membrane bounded cell projection organization
GO:0060271	0.953	cilium assembly
GO:0050896	0.952	response to stimulus
GO:0050794	0.943	regulation of cellular process
GO:0007399	0.814	nervous system development
GO:0007368	0.789	determination of left/right symmetry
GO:0042461	0.747	photoreceptor cell development
GO:0051179	0.720	localization
GO:0007423	0.652	sensory organ development
GO:0035295	0.635	tube development
GO:0009653	0.634	anatomical structure morphogenesis
GO:0048519	0.372	negative regulation of biological process
GO:0009888	0.343	tissue development
GO:0048523	0.337	negative regulation of cellular process
GO:0043583	0.337	ear development
GO:0060429	0.332	epithelium development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005815	1.000	microtubule organizing center
GO:0005737	0.999	cytoplasm
GO:0005929	0.996	cilium
GO:0005829	0.991	cytosol
GO:0005813	0.956	centrosome
GO:0036064	0.933	ciliary basal body
GO:0030054	0.714	cell junction
GO:0070161	0.702	anchoring junction
GO:0005911	0.470	cell-cell junction
GO:0032991	0.410	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]