StarFunc result for job id Q8N159

User Input

>input (534 residues)
MATALMAVVLRAAAVAPRLRGRGGTGGARRLSCGARRRAARGTSPGRRLSTAWSQPQPPP
EEYAGADDVSQSPVAEEPSWVPSPRPPVPHESPEPPSGRSLVQRDIQAFLNQCGASPGEA
RHWLTQFQTCHHSADKPFAVIEVDEEVLKCQQGVSSLAFALAFLQRMDMKPLVVLGLPAP
TAPSGCLSFWEAKAQLAKSCKVLVDALRHNAAAAVPFFGGGSVLRAAEPAPHASYGGIVS
VETDLLQWCLESGSIPILCPIGETAARRSVLLDSLEVTASLAKALRPTKIIFLNNTGGLR
DSSHKVLSNVNLPADLDLVCNAEWVSTKERQQMRLIVDVLSRLPHHSSAVITAASTLLTE
LFSNKGSGTLFKNAERMLRVRSLDKLDQGRLVDLVNASFGKKLRDDYLASLRPRLHSIYV
SEGYNAAAILTMEPVLGGTPYLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNP
INPWYFKHSDGSFSNKQWIFFWFGLADIRDSYELVNHAKGLPDSFHKPASDPGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N159	1.000	1.000	0.000	534	1.000	1.000	Q8N159.pdb.gz	NAGS_HUMAN N-acetylglutamate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=NAGS PE=1 SV=1
2	AFDB:Q8R4H7	0.820	0.831	1.136E-94	527	0.837	0.848	Q8R4H7.pdb.gz	NAGS_MOUSE N-acetylglutamate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Nags PE=1 SV=2
3	AFDB:A0A1D8PEI6	0.706	0.450	9.552E-39	857	0.227	0.141	A0A1D8PEI6.pdb.gz	A0A1D8PEI6_CANAL Bifunctional acetylglutamate kinase/N-acetyl-gamma-glutamyl-phosphate reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARG5:6 PE=3 SV=1
4	AFDB:P31318	0.704	0.437	1.286E-37	885	0.208	0.125	P31318.pdb.gz	ARG56_SCHPO Protein arg11, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg11 PE=1 SV=2
5	AFDB:Q01217	0.723	0.456	5.008E-37	863	0.225	0.139	Q01217.pdb.gz	ARG56_YEAST Protein ARG5,6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG5,6 PE=1 SV=1
6	AFDB:Q72C18	0.404	0.675	5.901E-16	308	0.103	0.179	Q72C18.pdb.gz	ARGB_DESVH Acetylglutamate kinase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=argB PE=1 SV=1
7	PDB:2v5hB	0.413	0.729	1.183E-15	289	0.105	0.194	2v5hB.pdb.gz	The Crystal Structure of the Complex of Pii and Acetylglutamate Kinase Reveals How Pii Controls the Storage of Nitrogen as Arginine.
8	PDB:2ap9A	0.401	0.687	7.855E-14	299	0.099	0.177	2ap9A.pdb.gz	Crystal structure of acetylglutamate kinase from Mycobacterium tuberculosis CDC1551
9	PDB:1gs5A	0.385	0.754	5.216E-12	258	0.081	0.167	1gs5A.pdb.gz	Structure of Acetylglutamate Kinase, a Key Enzyme for Arginine Biosynthesis and a Prototype for the Amino Acid Kinase Enzyme Family, During Catalysis
10	PDB:2j0wA	0.325	0.381	4.388E-10	447	0.118	0.141	2j0wA.pdb.gz	Structures of R- and T-State Escherichia Coli Aspartokinase III: Mechanisms of the Allosteric Transition and Inhibition by Lysine.
11	PDB:8crvA	0.314	0.505	5.570E-9	312	0.060	0.103	8crvA.pdb.gz	Crystal Structure of the Carbamate Kinase from Pseudomonas aeruginosa
12	PDB:3nwyB	0.304	0.644	3.699E-7	231	0.060	0.139	3nwyB.pdb.gz	Structural and functional characterization of the Mycobacterium tuberculosis uridine monophosphate kinase: insights into the allosteric regulation.
13	PDB:2j5tD	0.335	0.473	4.971E-7	365	0.062	0.090	2j5tD.pdb.gz	A Novel Two-Domain Architecture within the Amino Acid Kinase Enzyme Family Revealed by the Crystal Structure of Escherichia Coli Glutamate 5-Kinase.
14	PDB:2j5tH	0.307	0.467	4.971E-7	337	0.056	0.089	2j5tH.pdb.gz	A Novel Two-Domain Architecture within the Amino Acid Kinase Enzyme Family Revealed by the Crystal Structure of Escherichia Coli Glutamate 5-Kinase.
15	PDB:2bneB	0.309	0.636	3.707E-6	238	0.060	0.134	2bneB.pdb.gz	Structure of Escherichia Coli Ump Kinase Differs from that of Other Nucleoside Monophosphate Kinases and Sheds New Light on Enzyme Regulation.
16	PDB:6ygbA	0.198	0.564	6.310E-6	159	0.041	0.138	6ygbA.pdb.gz	Divergent architecture of the heterotrimeric NatC complex explains N-terminal acetylation of cognate substrates.
17	AFDB:Q9SB89	0.144	0.127	2.095E-3	633	0.082	0.070	Q9SB89.pdb.gz	RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana OX=3702 GN=RH27 PE=2 SV=2
18	AFDB:F4J2K2	0.122	0.110	5.084E-3	625	0.066	0.056	F4J2K2.pdb.gz	FPGS2_ARATH Folylpolyglutamate synthase OS=Arabidopsis thaliana OX=3702 GN=FPGS2 PE=1 SV=1
19	AFDB:P96217	0.158	0.200	5.084E-3	390	0.110	0.151	P96217.pdb.gz	P96217_MYCTU Conserved protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3860 PE=1 SV=1
20	AFDB:Q7XJM8	0.140	0.122	5.722E-3	640	0.105	0.087	Q7XJM8.pdb.gz	SCL27_ARATH Scarecrow-like protein 27 OS=Arabidopsis thaliana OX=3702 GN=SCL27 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	K7EK11	0.0	1026	511	0.942	0.984	K7EK11_HUMAN N-acetylglutamate synthase (Fragment) OS=Homo sapiens OX=9606 GN=NAGS PE=1 SV=1
2	Q8N159	0.0	1090	534	1.000	1.000	NAGS_HUMAN N-acetylglutamate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=NAGS PE=1 SV=1
3	Q8R4H7	0.0	905	527	0.856	0.867	NAGS_MOUSE N-acetylglutamate synthase, mitochondrial OS=Mus musculus OX=10090 GN=Nags PE=1 SV=2
4	E7FCP8	1.06e-157	461	527	0.461	0.467	NAGS_DANRE N-acetylglutamate synthase, mitochondrial OS=Danio rerio OX=7955 GN=nags PE=1 SV=1
5	Q555V8	6.38e-49	184	1112	0.238	0.114	Q555V8_DICDI Acetylglutamate kinase OS=Dictyostelium discoideum OX=44689 GN=argB PE=4 SV=2
6	Q01217	1.51e-32	135	863	0.219	0.136	ARG56_YEAST Protein ARG5,6, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG5,6 PE=1 SV=1
7	A0A1D8PEI6	5.09e-31	130	857	0.213	0.133	A0A1D8PEI6_CANAL Bifunctional acetylglutamate kinase/N-acetyl-gamma-glutamyl-phosphate reductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ARG5:6 PE=3 SV=1
8	Q4WCZ1	3.71e-29	124	906	0.215	0.127	Q4WCZ1_ASPFU Arginine-requiring protein 2 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G02910 PE=3 SV=1
9	P31318	1.07e-27	120	885	0.193	0.116	ARG56_SCHPO Protein arg11, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg11 PE=1 SV=2
10	O94330	2.74e-15	80.9	500	0.163	0.174	NAGS_SCHPO Amino-acid acetyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arg6 PE=3 SV=1
11	P40360	5.03e-07	54.7	574	0.064	0.059	NAGS_YEAST Amino-acid acetyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARG2 PE=1 SV=1
12	Q6V1L5	6.05e-04	44.3	301	0.079	0.140	ARGB_SYNE7 Acetylglutamate kinase OS=Synechococcus elongatus (strain ATCC 33912 / PCC 7942 / FACHB-805) OX=1140 GN=argB PE=1 SV=1
13	P22567	0.38	35.8	432	0.096	0.118	ARGA_PSEAE Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=argA PE=1 SV=2
14	Q15291	1.2	34.3	538	0.082	0.082	RBBP5_HUMAN Retinoblastoma-binding protein 5 OS=Homo sapiens OX=9606 GN=RBBP5 PE=1 SV=2
15	Q8BX09	1.3	34.3	538	0.082	0.082	RBBP5_MOUSE Retinoblastoma-binding protein 5 OS=Mus musculus OX=10090 GN=Rbbp5 PE=1 SV=2
16	A0A1D8PJ13	2.6	33.5	906	0.043	0.025	A0A1D8PJ13_CANAL Bifunctional hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FOX2 PE=3 SV=1
17	Q7ZUU9	3.8	32.7	512	0.079	0.082	Q7ZUU9_DANRE Retinoblastoma-binding protein 5 OS=Danio rerio OX=7955 GN=zgc:56078 PE=1 SV=1
18	O22241	6.5	32.0	424	0.067	0.085	AROD4_ARATH Arogenate dehydratase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ADT4 PE=1 SV=1
19	O74837	7.7	30.0	109	0.028	0.138	PMP31_SCHPO Plasma membrane proteolipid 31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmp31 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00696 AA_kinase	0.09	23.9	Amino acid kinase family
2	PF00583 Acetyltransf_1	6.5e+02	12.0	Acetyltransferase (GNAT) family
3	PF04768 NAT	1.2e-44	163.4	NAT, N-acetyltransferase, of N-acetylglutamate synthase
4	PF16501 SCAPER_N	5.8e+02	11.8	S phase cyclin A-associated protein in the endoplasmic reticulum

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000293404

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000039007	0.989	Ornithine carbamoyltransferase, mitochondrial
2	9606.ENSP00000361471	0.988	Argininosuccinate synthase
3	9606.ENSP00000307188	0.970	Argininosuccinate lyase
4	9606.ENSP00000277865	0.956	Glutamate dehydrogenase 1, mitochondrial
5	9606.ENSP00000327589	0.952	Glutamate dehydrogenase 2, mitochondrial
6	9606.ENSP00000402608	0.935	Carbamoyl-phosphate synthase [ammonia], mitochondrial
7	9606.ENSP00000378408	0.922	Alanine aminotransferase 1
8	9606.ENSP00000345282	0.921	Alanine aminotransferase 2
9	9606.ENSP00000359539	0.916	Aspartate aminotransferase, cytoplasmic
10	9606.ENSP00000245206	0.912	Aspartate aminotransferase, mitochondrial
11	9606.ENSP00000303077	0.907	Putative aspartate aminotransferase, cytoplasmic 2
12	9606.ENSP00000360268	0.883	Delta-1-pyrroline-5-carboxylate synthase
13	9606.ENSP00000477639	0.881	N-acetyl-D-glucosamine kinase
14	9606.ENSP00000357838	0.878	Ornithine aminotransferase, mitochondrial
15	9606.ENSP00000396527	0.856	annotation not available
16	9606.ENSP00000261783	0.783	Arginase-2, mitochondrial
17	9606.ENSP00000349446	0.783	Arginase-1
18	9606.ENSP00000234111	0.705	Ornithine decarboxylase
19	9606.ENSP00000269298	0.700	Diamine acetyltransferase 2
20	9606.ENSP00000423674	0.698	Glucosamine-6-phosphate isomerase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004042	1.000	acetyl-CoA:L-glutamate N-acetyltransferase activity
GO:0005488	0.776	binding
GO:0005515	0.499	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901564	0.990	organonitrogen compound metabolic process
GO:0044281	0.987	small molecule metabolic process
GO:0006536	0.982	glutamate metabolic process
GO:0009058	0.873	biosynthetic process
GO:1901576	0.800	organic substance biosynthetic process
GO:0044249	0.742	cellular biosynthetic process
GO:1901566	0.731	organonitrogen compound biosynthetic process
GO:0044271	0.693	cellular nitrogen compound biosynthetic process
GO:0043604	0.355	amide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.888	mitochondrial matrix
GO:0005829	0.560	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24292	1.000	acetyl-CoA + L-glutamate = CoA + H(+) + N-acetyl-L-glutamate
EC:2.3.1.1	1.000	amino-acid N-acetyltransferase.

[back to server]