StarFunc result for job id Q8N163

User Input

>input (923 residues)
MSQFKRQRINPLPGGRNFSGTASTSLLGPPPGLLTPPVATELSQNARHLQGGEKQRVFTG
IVTSLHDYFGVVDEEVFFQLSVVKGRLPQLGEKVLVKAAYNPGQAVPWNAVKVQTLSNQP
LLKSPAPPLLHVAALGQKQGILGAQPQLIFQPHRIPPLFPQKPLSLFQTSHTLHLSHLNR
FPARGPHGRLDQGRSDDYDSKKRKQRAGGEPWGAKKPRHDLPPYRVHLTPYTVDSPICDF
LELQRRYRSLLVPSDFLSVHLSWLSAFPLSQPFSLHHPSRIQVSSEKEAAPDAGAEPITA
DSDPAYSSKVLLLSSPGLEELYRCCMLFVDDMAEPRETPEHPLKQIKFLLGRKEEEAVLV
GGEWSPSLDGLDPQADPQVLVRTAIRCAQAQTGIDLSGCTKWWRFAEFQYLQPGPPRRLQ
TVVVYLPDVWTIMPTLEEWEALCQQKAAEAAPPTQEAQGETEPTEQAPDALEQAADTSRR
NAETPEATTQQETDTDLPEAPPPPLEPAVIARPGCVNLSLHGIVEDRRPKERISFEVMVL
AELFLEMLQRDFGYRVYKMLLSLPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKD
EAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALDPELLLLRDDGE
EEFAGAKLEDSEVRSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYL
HRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRSLQYSRQEGLDGGLPEEVLFGNL
DLLPPPGKSTKPGAAPTEHKALVSHNGSLINVGSLLQRAEQQDSGRLYLENKIHTLELKL
EESHNRFSATEVTNKTLAAEMQELRVRLAEAEETARTAERQKSQLQRLLQELRRRLTPLQ
LEIQRVVEKADSWVEKEEPAPSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N163	1.000	1.000	0.000	923	1.000	1.000	Q8N163.pdb.gz	CCAR2_HUMAN Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2
2	AFDB:Q8IX12	0.401	0.325	6.320E-61	1150	0.359	0.288	Q8IX12.pdb.gz	CCAR1_HUMAN Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2
3	PDB:3aqqA	0.064	0.493	3.192E-3	99	0.017	0.162	3aqqA.pdb.gz
4	AFDB:Q586F1	0.043	0.024	1.028E-2	1992	0.120	0.056	Q586F1.pdb.gz	Q586F1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.305 PE=4 SV=1
5	PDB:3kf6B	0.066	0.449	4.172E-2	105	0.012	0.105	3kf6B.pdb.gz
6	AFDB:O62203	0.067	0.059	4.396E-2	1073	0.128	0.110	O62203.pdb.gz	PHM2_CAEEL Pharyngeal muscle protein 2 OS=Caenorhabditis elegans OX=6239 GN=phm-2 PE=1 SV=3
7	AFDB:Q57TU8	0.046	0.060	5.813E-2	666	0.111	0.153	Q57TU8.pdb.gz	Q57TU8_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.520 PE=4 SV=1
8	AFDB:E1JIP0	0.064	0.080	6.147E-2	717	0.139	0.179	E1JIP0.pdb.gz	E1JIP0_DROME FI18283p1 OS=Drosophila melanogaster OX=7227 GN=sr PE=2 SV=1
9	PDB:2c35B	0.061	0.267	6.168E-2	171	0.010	0.053	2c35B.pdb.gz
10	PDB:1zeqX	0.065	0.527	7.294E-2	84	0.010	0.107	1zeqX.pdb.gz
11	PDB:5datC1	0.050	0.240	8.156E-2	155	0.018	0.110	5datC1.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
12	PDB:2gt4A	0.073	0.312	1.206E-1	160	0.020	0.113	2gt4A.pdb.gz	X-ray, NMR, and mutational studies of the catalytic cycle of the GDP-mannose mannosyl hydrolase reaction.
13	PDB:3h0gG	0.058	0.266	1.275E-1	170	0.013	0.071	3h0gG.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
14	PDB:4v6wAL	0.057	0.283	1.349E-1	155	0.013	0.077	4v6wAL.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	AFDB:Q9JJG0	0.101	0.083	1.589E-1	1149	0.161	0.130	Q9JJG0.pdb.gz	TACC2_MOUSE Transforming acidic coiled-coil-containing protein 2 OS=Mus musculus OX=10090 GN=Tacc2 PE=1 SV=2
16	PDB:5gp0I	0.076	0.433	1.595E-1	139	0.018	0.122	5gp0I.pdb.gz	Structural Insights into the Substrate Recognition Mechanism of Arabidopsis GPP-Bound NUDX1 for Noncanonical Monoterpene Biosynthesis.
17	PDB:2rrkA	0.065	0.364	1.886E-1	140	0.011	0.071	2rrkA.pdb.gz
18	AFDB:Q9VMA7	0.049	0.032	1.987E-1	1430	0.137	0.088	Q9VMA7.pdb.gz	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
19	AFDB:A0A0G2K850	0.049	0.063	2.350E-1	651	0.098	0.138	A0A0G2K850.pdb.gz	A0A0G2K850_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2
20	AFDB:Q96R06	0.059	0.049	3.107E-1	1193	0.118	0.091	Q96R06.pdb.gz	SPAG5_HUMAN Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E2PSM9	0.0	721	365	0.395	1.000	E2PSM9_HUMAN cDNA FLJ12599 fis, clone NT2RM4001410 OS=Homo sapiens OX=9606 PE=1 SV=1
2	G3V119	0.0	1167	598	0.633	0.977	G3V119_HUMAN Cell cycle and apoptosis regulator 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=1
3	H0YB24	0.0	1230	615	0.665	0.998	H0YB24_HUMAN Cell cycle and apoptosis regulator 2 (Fragment) OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=1
4	Q8N163	0.0	1868	923	1.000	1.000	CCAR2_HUMAN Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2
5	Q8VDP4	0.0	1579	922	0.914	0.915	CCAR2_MOUSE Cell cycle and apoptosis regulator protein 2 OS=Mus musculus OX=10090 GN=Ccar2 PE=1 SV=2
6	Q8IX12	3.21e-28	125	1150	0.081	0.065	CCAR1_HUMAN Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2
7	Q8CH18	6.93e-28	124	1146	0.083	0.067	CCAR1_MOUSE Cell division cycle and apoptosis regulator protein 1 OS=Mus musculus OX=10090 GN=Ccar1 PE=1 SV=1
8	A0A0S4XR43	4.41e-26	118	1215	0.077	0.058	A0A0S4XR43_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccar-1 PE=1 SV=1
9	H2KMJ3	4.80e-25	113	659	0.077	0.108	H2KMJ3_CAEEL DBC1/CARP1 catalytically inactive NUDIX hydrolase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccar-1 PE=1 SV=1
10	G5EBS4	4.65e-22	103	509	0.065	0.118	G5EBS4_CAEEL DBC1/CARP1 catalytically inactive NUDIX hydrolase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccar-1 PE=1 SV=1
11	Q86A78	3.02e-19	96.3	1282	0.091	0.066	Q86A78_DICDI Calcium-binding EF-hand domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1124 PE=4 SV=1
12	F4IS91	2.57e-16	86.7	1340	0.069	0.048	RSA1_ARATH Protein SHORT ROOT IN SALT MEDIUM 1 OS=Arabidopsis thaliana OX=3702 GN=RSA1 PE=1 SV=1
13	Q12019	0.13	38.9	4910	0.033	0.006	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
14	B7Z0E2	0.49	36.6	1057	0.029	0.026	B7Z0E2_DROME FI18812p1 OS=Drosophila melanogaster OX=7227 GN=Unr PE=1 SV=1
15	Q9VSK3	0.49	36.6	1039	0.029	0.026	Q9VSK3_DROME Upstream of N-ras, isoform A OS=Drosophila melanogaster OX=7227 GN=Unr PE=1 SV=2
16	Q54IY3	0.70	34.7	151	0.024	0.146	CETNA_DICDI Centrin-A OS=Dictyostelium discoideum OX=44689 GN=cenA PE=3 SV=1
17	Q8IHN4	0.85	36.2	6093	0.034	0.005	Q8IHN4_PLAF7 Antigen 332, DBL-like protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1149000 PE=4 SV=2
18	O13834	1.1	35.8	3227	0.034	0.010	PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr1 PE=1 SV=1
19	Q8WUE5	1.2	34.7	264	0.017	0.061	CT55_HUMAN Cancer/testis antigen 55 OS=Homo sapiens OX=9606 GN=CT55 PE=1 SV=1
20	Q02440	1.4	35.4	1829	0.036	0.018	MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus OX=9031 GN=MYO5A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	64	15.1	Afadin- and alpha -actinin-Binding
2	PF10046 BLOC1_2	7.7e+02	11.9	Biogenesis of lysosome-related organelles complex-1 subunit 2
3	PF19257 BURAN	2.2e-11	55.7	BURAN domain
4	PF14443 DBC1	3.5e-39	145.0	DBC1
5	PF16832 EKLF_TAD1	19	16.6	Erythroid krueppel-like transcription factor, transactivation 1
6	PF14662 KASH_CCD	25	16.2	Coiled-coil region of CCDC155 or KASH
7	PF19256 LAIKA	8.1e-10	49.7	LAIKA domain
8	PF14444 S1-like	1.2e-26	103.9	S1-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310670

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000212015	0.996	NAD-dependent protein deacetylase sirtuin-1
2	9606.ENSP00000432083	0.979	Heat shock cognate 71 kDa protein
3	9606.ENSP00000340796	0.966	DBIRD complex subunit ZNF326
4	9606.ENSP00000278616	0.929	Serine-protein kinase ATM
5	9606.ENSP00000343741	0.918	Serine/threonine-protein kinase ATR
6	9606.ENSP00000364805	0.913	Heat shock 70 kDa protein 1-like
7	9606.ENSP00000254322	0.903	DnaJ homolog subfamily B member 1
8	9606.ENSP00000431512	0.903	Heat shock factor protein 1
9	9606.ENSP00000364801	0.901	Heat shock protein family A member 1B
10	9606.ENSP00000364802	0.901	Heat shock 70 kDa protein 1A
11	9606.ENSP00000378199	0.901	Heat shock-related 70 kDa protein 2
12	9606.ENSP00000368066	0.878	Hydroxyacid oxidase 1
13	9606.ENSP00000363822	0.780	Androgen receptor
14	9606.ENSP00000253329	0.746	Peptidyl-prolyl cis-trans isomerase-like 4
15	9606.ENSP00000359727	0.727	BAG family molecular chaperone regulator 2
16	9606.ENSP00000319169	0.711	Protein arginine N-methyltransferase 5
17	9606.ENSP00000372023	0.708	Serine/threonine-protein kinase Chk2
18	9606.ENSP00000367323	0.701	Voltage-gated potassium channel subunit beta-2
19	9606.ENSP00000370695	0.698	Exocyst complex component 1
20	9606.ENSP00000418960	0.689	Breast cancer type 1 susceptibility protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004857	1.000	enzyme inhibitor activity
GO:0003723	0.998	RNA binding
GO:0019899	0.985	enzyme binding
GO:0043175	0.975	RNA polymerase core enzyme binding
GO:0000993	0.972	RNA polymerase II complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050789	0.993	regulation of biological process
GO:0009987	0.983	cellular process
GO:0050794	0.979	regulation of cellular process
GO:0019222	0.973	regulation of metabolic process
GO:0060255	0.952	regulation of macromolecule metabolic process
GO:0008152	0.946	metabolic process
GO:0051171	0.943	regulation of nitrogen compound metabolic process
GO:0048519	0.942	negative regulation of biological process
GO:0080090	0.942	regulation of primary metabolic process
GO:0071704	0.939	organic substance metabolic process
GO:0031323	0.937	regulation of cellular metabolic process
GO:0065009	0.931	regulation of molecular function
GO:0044238	0.917	primary metabolic process
GO:0006807	0.917	nitrogen compound metabolic process
GO:0043170	0.913	macromolecule metabolic process
GO:0048522	0.909	positive regulation of cellular process
GO:0048523	0.903	negative regulation of cellular process
GO:0019219	0.899	regulation of nucleobase-containing compound metabolic process
GO:0044237	0.886	cellular metabolic process
GO:0010468	0.883	regulation of gene expression
GO:0051252	0.882	regulation of RNA metabolic process
GO:0010605	0.879	negative regulation of macromolecule metabolic process
GO:0051172	0.877	negative regulation of nitrogen compound metabolic process
GO:0010556	0.871	regulation of macromolecule biosynthetic process
GO:0031326	0.871	regulation of cellular biosynthetic process
GO:0031324	0.868	negative regulation of cellular metabolic process
GO:0048583	0.865	regulation of response to stimulus
GO:0034641	0.856	cellular nitrogen compound metabolic process
GO:0006725	0.854	cellular aromatic compound metabolic process
GO:0050790	0.844	regulation of catalytic activity
GO:0016043	0.835	cellular component organization
GO:2001141	0.833	regulation of RNA biosynthetic process
GO:0090304	0.811	nucleic acid metabolic process
GO:0006355	0.811	regulation of DNA-templated transcription
GO:0050896	0.781	response to stimulus
GO:0043086	0.777	negative regulation of catalytic activity
GO:0045934	0.756	negative regulation of nucleobase-containing compound metabolic process
GO:0009966	0.744	regulation of signal transduction
GO:0051726	0.702	regulation of cell cycle
GO:0080134	0.693	regulation of response to stress
GO:0051246	0.680	regulation of protein metabolic process
GO:0051253	0.675	negative regulation of RNA metabolic process
GO:0051128	0.651	regulation of cellular component organization
GO:0016070	0.651	RNA metabolic process
GO:0010467	0.468	gene expression
GO:0009890	0.457	negative regulation of biosynthetic process
GO:0010558	0.448	negative regulation of macromolecule biosynthetic process
GO:0010564	0.411	regulation of cell cycle process
GO:0031327	0.400	negative regulation of cellular biosynthetic process
GO:0006996	0.386	organelle organization
GO:1902531	0.364	regulation of intracellular signal transduction
GO:0048584	0.358	positive regulation of response to stimulus
GO:0010604	0.353	positive regulation of macromolecule metabolic process
GO:0051173	0.351	positive regulation of nitrogen compound metabolic process
GO:0080135	0.342	regulation of cellular response to stress
GO:1902679	0.338	negative regulation of RNA biosynthetic process
GO:0048585	0.336	negative regulation of response to stimulus
GO:2001020	0.332	regulation of response to DNA damage stimulus
GO:0010941	0.328	regulation of cell death
GO:0042981	0.323	regulation of apoptotic process
GO:1903507	0.305	negative regulation of nucleic acid-templated transcription
GO:0045892	0.304	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0032991	0.990	protein-containing complex
GO:0005737	0.990	cytoplasm
GO:0005694	0.962	chromosome
GO:0005829	0.894	cytosol
GO:0005739	0.872	mitochondrion
GO:0140535	0.749	intracellular protein-containing complex
GO:0015630	0.740	microtubule cytoskeleton
GO:0000785	0.729	chromatin
GO:0005819	0.554	spindle
GO:0044609	0.381	DBIRD complex
GO:0005759	0.342	mitochondrial matrix
GO:0016020	0.339	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]