StarFunc result for job id Q8N187

User Input

>input (725 residues)
MEQSNDSLRVNHNDGEESKTSAQVFEHLICMDSRDSSFGQNDSPTVLPITTREANNSLIS
QNIPGPLTQTQTLSAEQFHLVDQNGQAIQYELQSLGESNAQMMIVASPTENGQVLRVIPP
TQTGMAQVIIPQGQLVDVNSPRDVPEEKPSNRNLPTVRVDTLADNTSNYILHPQTSFPLP
KKSVTGMLEEPLLGPLQPLSSNTPIWACRLRSCEKIGDSYRGYCVSETELESVLTFHKQQ
TQSVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSRAVVMECQYGPRRKGFQLKKV
SEQESRSCQLYKATCPARIYIKKVQKFPEYRVPTDPKIDKKIIRMEQEKAFNMLKKNLVD
AGGVLRWYVQLPTQQAHQYHELETPCLTLSPSPFPVSSLEEEETAVRDENCALPSRLHPQ
VAHKIQELVSQGIEQVYAVRKQLRKFVERELFKPDEVPERHNLSFFPTVNDIKNHIHEVQ
KSLRNGDTVYNSEIIPATLQWTTDSGNILKETMTVTFAEGNSPGESITTKVETNQTRGSL
SPEPTHLLSSLSSFQPKIFTQLQGLQLQPRYTSPDESPAVVSVNNQPSSSPSGLLDTIGS
AVMNNNSLLLGQSHSLQRDTCLTQNNSTASTMGNLPEPDQNLVAMDELVEVGDVEDTGNL
EGTVHRILLGDVQTIPIQIIDNHSALIEENPESTISVSQVKQEPKEPALSMEAKKTVDYK
KLSAT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N187	1.000	1.000	0.000	725	1.000	1.000	Q8N187.pdb.gz	CARTF_HUMAN Calcium-responsive transcription factor OS=Homo sapiens OX=9606 GN=CARF PE=1 SV=2
2	AFDB:A0A087WT53	0.047	0.042	5.489E-4	1155	0.137	0.086	A0A087WT53.pdb.gz	A0A087WT53_HUMAN Membrane associated guanylate kinase, WW and PDZ domain containing 1 OS=Homo sapiens OX=9606 GN=MAGI1 PE=1 SV=1
3	AFDB:P85037	0.069	0.068	3.291E-3	733	0.116	0.115	P85037.pdb.gz	FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1 PE=1 SV=1
4	AFDB:H3BJD6	0.064	0.041	4.117E-3	1292	0.152	0.085	H3BJD6.pdb.gz	H3BJD6_MOUSE Protein phosphatase 1, regulatory subunit 9A OS=Mus musculus OX=10090 GN=Ppp1r9a PE=1 SV=1
5	AFDB:P28006	0.056	0.046	3.862E-2	793	0.157	0.144	P28006.pdb.gz	GAC1_YEAST Serine/threonine-protein phosphatase 1 regulatory subunit GAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GAC1 PE=1 SV=2
6	AFDB:P13002	0.040	0.027	1.655E-1	1333	0.135	0.074	P13002.pdb.gz	ELF1_DROME Protein grainyhead OS=Drosophila melanogaster OX=7227 GN=grh PE=1 SV=3
7	AFDB:E7F9I2	0.057	0.084	1.750E-1	431	0.061	0.102	E7F9I2.pdb.gz	E7F9I2_DANRE SRY-box transcription factor 18 OS=Danio rerio OX=7955 GN=sox18 PE=4 SV=1
8	AFDB:Q8JIR8	0.058	0.050	1.851E-1	928	0.116	0.091	Q8JIR8.pdb.gz	IMPG1_CHICK Interphotoreceptor matrix proteoglycan 1 OS=Gallus gallus OX=9031 GN=IMPG1 PE=1 SV=1
9	AFDB:Q6SJR1	0.087	0.088	2.739E-1	720	0.068	0.068	Q6SJR1.pdb.gz	TAF4_ARATH Transcription initiation factor TFIID subunit 4 OS=Arabidopsis thaliana OX=3702 GN=TAF4 PE=1 SV=1
10	AFDB:P39969	0.072	0.057	2.897E-1	1040	0.126	0.087	P39969.pdb.gz	BOI2_YEAST Protein BOI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOI2 PE=1 SV=1
11	PDB:1kv9A	0.062	0.066	4.816E-1	664	0.025	0.027	1kv9A.pdb.gz	Structure at 1.9 A resolution of a quinohemoprotein alcohol dehydrogenase from Pseudomonas putida HK5.
12	PDB:7mq8LJ	0.054	0.074	7.126E-1	469	0.044	0.068	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:3w40A	0.049	0.123	8.914E-1	199	0.025	0.090	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
14	PDB:6rrmA	0.033	0.061	1.115	351	0.011	0.023	6rrmA.pdb.gz	Targeting the Mycobacterium tuberculosis transpeptidase LdtMt2with cysteine-reactive inhibitors including ebselen.
15	PDB:3hksA	0.048	0.199	1.247	144	0.007	0.035	3hksA.pdb.gz
16	PDB:5zwob	0.039	0.197	1.247	77	0.017	0.156	5zwob.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
17	PDB:6bk8M	0.035	0.061	1.319	326	0.018	0.040	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
18	PDB:3jb9E	0.039	0.172	1.395	98	0.012	0.092	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
19	PDB:3tgoD	0.062	0.179	1.845	186	0.028	0.108	3tgoD.pdb.gz
20	PDB:6b2eB	0.044	0.149	1.845	193	0.018	0.067	6b2eB.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A7U2	0.0	906	587	0.630	0.779	CARTF_RAT Calcium-responsive transcription factor OS=Rattus norvegicus OX=10116 GN=Carf PE=1 SV=1
2	Q8N187	0.0	1496	725	1.000	1.000	CARTF_HUMAN Calcium-responsive transcription factor OS=Homo sapiens OX=9606 GN=CARF PE=1 SV=2
3	Q8VHI4	0.0	1027	689	0.713	0.750	CARTF_MOUSE Calcium-responsive transcription factor OS=Mus musculus OX=10090 GN=Carf PE=2 SV=1
4	Q6ZUJ8	3.9	33.5	805	0.037	0.034	BCAP_HUMAN Phosphoinositide 3-kinase adapter protein 1 OS=Homo sapiens OX=9606 GN=PIK3AP1 PE=1 SV=2
5	Q86TB3	8.8	32.3	2170	0.029	0.010	ALPK2_HUMAN Alpha-protein kinase 2 OS=Homo sapiens OX=9606 GN=ALPK2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15299 ALS2CR8	2.9e-83	291.0	Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384006

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000391504	0.834	Coiled-coil domain containing 173
2	9606.ENSP00000287859	0.754	Protein odr-4 homolog
3	9606.ENSP00000420237	0.736	M14 carboxypeptidases
4	9606.ENSP00000264167	0.690	Alkyldihydroxyacetonephosphate synthase, peroxisomal
5	9606.ENSP00000399903	0.641	Neurobeachin-like protein 1
6	9606.ENSP00000233047	0.574	Promethin
7	9606.ENSP00000297267	0.574	Fibronectin type III domain-containing protein 1
8	9606.ENSP00000346027	0.573	60S ribosomal protein L21
9	9606.ENSP00000357000	0.539	Upstream stimulatory factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.999	DNA binding
GO:0001228	0.999	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050896	0.964	response to stimulus
GO:0051716	0.901	cellular response to stimulus
GO:0042221	0.898	response to chemical
GO:0010033	0.893	response to organic substance
GO:0070887	0.807	cellular response to chemical stimulus
GO:0050794	0.790	regulation of cellular process
GO:1901700	0.762	response to oxygen-containing compound
GO:0051592	0.745	response to calcium ion
GO:1901701	0.744	cellular response to oxygen-containing compound
GO:0048518	0.710	positive regulation of biological process
GO:0048522	0.700	positive regulation of cellular process
GO:0071277	0.658	cellular response to calcium ion
GO:0019222	0.602	regulation of metabolic process
GO:0060255	0.588	regulation of macromolecule metabolic process
GO:0080090	0.577	regulation of primary metabolic process
GO:0051171	0.577	regulation of nitrogen compound metabolic process
GO:0010604	0.548	positive regulation of macromolecule metabolic process
GO:0031323	0.544	regulation of cellular metabolic process
GO:0010468	0.521	regulation of gene expression
GO:0051173	0.514	positive regulation of nitrogen compound metabolic process
GO:0031325	0.510	positive regulation of cellular metabolic process
GO:0006355	0.503	regulation of DNA-templated transcription
GO:0045935	0.422	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.321	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.997	nuclear lumen
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005654	0.683	nucleoplasm
GO:0005730	0.573	nucleolus
GO:0005737	0.302	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]