StarFunc result for job id Q8N196

User Input

>input (739 residues)
MATLPAEPSAGPAAGGEAVAAAAATEEEEEEARQLLQTLQAAEGEAAAAAGAGAGAAAAG
AEGPGSPGVPGSPPEAASEPPTGLRFSPEQVACVCEALLQAGHAGRLSRFLGALPPAERL
RGSDPVLRARALVAFQRGEYAELYRLLESRPFPAAHHAFLQDLYLRARYHEAERARGRAL
GAVDKYRLRKKFPLPKTIWDGEETVYCFKERSRAALKACYRGNRYPTPDEKRRLATLTGL
SLTQVSNWFKNRRQRDRTGAGGGAPCKSESDGNPTTEDESSRSPEDLERGAAPVSAEAAA
QGSIFLAGTGPPAPCPASSSILVNGSFLAASGSPAVLLNGGPVIINGLALGEASSLGPLL
LTGGGGAPPPQPSPQGASETKTSLVLDPQTGEVRLEEAQSEAPETKGAQVAAPGPALGEE
VLGPLAQVVPGPPTAATFPLPPGPVPAVAAPQVVPLSPPPGYPTGLSPTSPLLNLPQVVP
TSQVVTLPQAVGPLQLLAAGPGSPVKVAAAAGPANVHLINSGVGVTALQLPSATAPGNFL
LANPVSGSPIVTGVALQQGKIILTATFPTSMLVSQVLPPAPGLALPLKPETAISVPEGGL
PVAPSPALPEAHALGTLSAQQPPPAAATTSSTSLPFSPDSPGLLPNFPAPPPEGLMLSPA
AVPVWSAGLELSAGTEGLLEAEKGLGTQAPHTVLRLPDPDPEGLLLGATAGGEVDEGLEA
EAKVLTQLQSVPVEEPLEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N196	1.000	1.000	5.613E-98	739	1.000	1.000	Q8N196.pdb.gz	SIX5_HUMAN Homeobox protein SIX5 OS=Homo sapiens OX=9606 GN=SIX5 PE=1 SV=3
2	AFDB:A0A0G2K7K3	0.423	0.433	1.368E-80	720	0.851	0.874	A0A0G2K7K3.pdb.gz	A0A0G2K7K3_RAT SIX homeobox 5 OS=Rattus norvegicus OX=10116 GN=Six5 PE=3 SV=1
3	AFDB:Q9UIU6	0.238	0.226	7.545E-25	781	0.310	0.293	Q9UIU6.pdb.gz	SIX4_HUMAN Homeobox protein SIX4 OS=Homo sapiens OX=9606 GN=SIX4 PE=1 SV=2
4	PDB:4egcA	0.160	0.215	1.613E-16	539	0.130	0.178	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
5	AFDB:P31264	0.073	0.069	1.427E-2	782	0.114	0.107	P31264.pdb.gz	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
6	PDB:2hi3A	0.077	0.614	3.815E-2	73	0.027	0.274	2hi3A.pdb.gz
7	AFDB:F4HZK4	0.058	0.038	9.868E-2	1608	0.141	0.065	F4HZK4.pdb.gz	REC3_ARATH Protein REDUCED CHLOROPLAST COVERAGE 3 OS=Arabidopsis thaliana OX=3702 GN=REC3 PE=3 SV=1
8	AFDB:Q6GNV6	0.048	0.042	1.045E-1	856	0.134	0.116	Q6GNV6.pdb.gz	CTIP_XENLA DNA endonuclease RBBP8 OS=Xenopus laevis OX=8355 GN=rbbp8 PE=1 SV=1
9	AFDB:Q9S9P0	0.092	0.077	1.170E-1	990	0.120	0.090	Q9S9P0.pdb.gz	PDS5E_ARATH Sister chromatid cohesion protein PDS5 homolog E OS=Arabidopsis thaliana OX=3702 GN=PDS5E PE=2 SV=1
10	AFDB:Q54LJ4	0.086	0.037	1.311E-1	2563	0.149	0.043	Q54LJ4.pdb.gz	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1
11	AFDB:O16117	0.085	0.077	1.469E-1	844	0.123	0.108	O16117.pdb.gz	O16117_DROME Shaven, isoform A OS=Drosophila melanogaster OX=7227 GN=sv PE=2 SV=1
12	PDB:7puaFX	0.098	0.277	1.494E-1	220	0.024	0.082	7puaFX.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
13	AFDB:F4HS99	0.071	0.035	2.451E-1	1797	0.161	0.066	F4HS99.pdb.gz	REC1_ARATH Protein REDUCED CHLOROPLAST COVERAGE 1 OS=Arabidopsis thaliana OX=3702 GN=REC1 PE=1 SV=1
14	PDB:7msnA	0.081	0.122	2.792E-1	417	0.038	0.067	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.
15	PDB:7puaFO	0.090	0.176	2.792E-1	328	0.032	0.073	7puaFO.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
16	PDB:2pziA	0.088	0.097	2.955E-1	654	0.039	0.044	2pziA.pdb.gz	Structural basis for the specific inhibition of protein kinase G, a virulence factor of Mycobacterium tuberculosis.
17	PDB:4kvmB	0.104	0.106	3.927E-1	722	0.035	0.036	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
18	PDB:2fi7A	0.107	0.268	4.400E-1	223	0.047	0.157	2fi7A.pdb.gz
19	PDB:5udkA	0.105	0.155	4.658E-1	461	0.037	0.059	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
20	PDB:8a3tJ	0.110	0.146	5.219E-1	509	0.024	0.035	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K7K3	0.0	1070	720	0.834	0.856	A0A0G2K7K3_RAT SIX homeobox 5 OS=Rattus norvegicus OX=10116 GN=Six5 PE=3 SV=1
2	P70178	0.0	1090	719	0.777	0.798	SIX5_MOUSE Homeobox protein SIX5 OS=Mus musculus OX=10090 GN=Six5 PE=1 SV=2
3	Q8N196	0.0	1411	739	1.000	1.000	SIX5_HUMAN Homeobox protein SIX5 OS=Homo sapiens OX=9606 GN=SIX5 PE=1 SV=3
4	Q61321	1.05e-99	326	775	0.225	0.214	SIX4_MOUSE Homeobox protein SIX4 OS=Mus musculus OX=10090 GN=Six4 PE=1 SV=1
5	Q9UIU6	3.92e-99	325	781	0.226	0.214	SIX4_HUMAN Homeobox protein SIX4 OS=Homo sapiens OX=9606 GN=SIX4 PE=1 SV=2
6	Q9Y1P6	1.53e-79	261	392	0.154	0.291	Q9Y1P6_DROME GM13131p OS=Drosophila melanogaster OX=7227 GN=Six4 PE=2 SV=1
7	Q27350	1.37e-73	246	416	0.160	0.284	SO_DROME Protein sine oculis OS=Drosophila melanogaster OX=7227 GN=so PE=2 SV=1
8	Q6DHF9	1.16e-70	234	283	0.152	0.396	SIX1A_DANRE Homeobox protein six1a OS=Danio rerio OX=7955 GN=six1a PE=2 SV=2
9	Q62232	1.66e-70	234	296	0.145	0.361	SIX2_MOUSE Homeobox protein SIX2 OS=Mus musculus OX=10090 GN=Six2 PE=1 SV=2
10	Q98TH1	2.30e-70	233	288	0.143	0.368	Q98TH1_DANRE Homeobox protein SIX2 OS=Danio rerio OX=7955 GN=six2.1 PE=2 SV=1
11	Q6NZ04	2.48e-70	233	284	0.153	0.398	SIX1B_DANRE Homeobox protein six1b OS=Danio rerio OX=7955 GN=six1b PE=1 SV=1
12	Q9NPC8	2.96e-70	233	291	0.145	0.368	SIX2_HUMAN Homeobox protein SIX2 OS=Homo sapiens OX=9606 GN=SIX2 PE=1 SV=1
13	G3V970	2.45e-69	231	284	0.143	0.373	G3V970_RAT SIX homeobox 1 OS=Rattus norvegicus OX=10116 GN=Six1 PE=3 SV=1
14	Q62231	2.45e-69	231	284	0.143	0.373	SIX1_MOUSE Homeobox protein SIX1 OS=Mus musculus OX=10090 GN=Six1 PE=1 SV=2
15	Q15475	2.81e-69	231	284	0.143	0.373	SIX1_HUMAN Homeobox protein SIX1 OS=Homo sapiens OX=9606 GN=SIX1 PE=1 SV=1
16	Q94166	5.43e-65	218	261	0.130	0.368	HM33_CAEEL Homeobox protein ceh-33 OS=Caenorhabditis elegans OX=6239 GN=ceh-33 PE=3 SV=1
17	O93282	3.60e-60	205	256	0.139	0.402	O93282_DANRE Homeobox protein Six7 OS=Danio rerio OX=7955 GN=six7 PE=2 SV=1
18	O95475	3.95e-59	202	246	0.146	0.439	SIX6_HUMAN Homeobox protein SIX6 OS=Homo sapiens OX=9606 GN=SIX6 PE=1 SV=2
19	Q9QZ28	1.89e-57	197	246	0.135	0.407	SIX6_MOUSE Homeobox protein SIX6 OS=Mus musculus OX=10090 GN=Six6 PE=1 SV=2
20	Q5TYZ2	3.72e-57	197	245	0.131	0.396	Q5TYZ2_DANRE SIX homeobox 6b OS=Danio rerio OX=7955 GN=zgc:110344 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	2.3e-05	35.5	Homeobox KN domain
2	PF00046 Homeodomain	1.1e-09	49.3	Homeodomain
3	PF16878 SIX1_SD	1.4e-35	133.6	Transcriptional regulator, SIX1, N-terminal SD domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316842

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342626	0.961	Eyes absent homolog 1
2	9606.ENSP00000432770	0.751	Eyes absent homolog 4
3	9606.ENSP00000345997	0.747	Myotonin-protein kinase
4	9606.ENSP00000362978	0.707	Eyes absent homolog 3
5	9606.ENSP00000333640	0.705	Eyes absent homolog 2
6	9606.ENSP00000270223	0.698	Dystrophia myotonica WD repeat-containing protein
7	9606.ENSP00000264010	0.644	Transcriptional repressor CTCF
8	9606.ENSP00000379847	0.643	Zinc finger protein 143
9	9606.ENSP00000370194	0.640	GDP-mannose 4,6 dehydratase
10	9606.ENSP00000457241	0.632	Translin-associated factor X-interacting protein 1
11	9606.ENSP00000243786	0.627	Inhibin alpha chain
12	9606.ENSP00000295228	0.622	Inhibin beta B chain
13	9606.ENSP00000402674	0.620	Basic helix-loop-helix and HMG box domain-containing protein 1
14	9606.ENSP00000481185	0.613	Grifin
15	9606.ENSP00000322242	0.604	RING finger protein 10
16	9606.ENSP00000410689	0.603	Actin filament-associated protein 1
17	9606.ENSP00000233813	0.592	Insulin-like growth factor-binding protein 5
18	9606.ENSP00000265748	0.577	Anillin
19	9606.ENSP00000282486	0.563	Muscleblind-like protein 1
20	9606.ENSP00000349595	0.555	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.962	heterocyclic compound binding
GO:0097159	0.962	organic cyclic compound binding
GO:0003677	0.952	DNA binding
GO:0043565	0.906	sequence-specific DNA binding
GO:0003690	0.902	double-stranded DNA binding
GO:1990837	0.757	sequence-specific double-stranded DNA binding
GO:0000981	0.490	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.355	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0010468	0.996	regulation of gene expression
GO:0051252	0.991	regulation of RNA metabolic process
GO:0048518	0.990	positive regulation of biological process
GO:0006355	0.982	regulation of DNA-templated transcription
GO:0009987	0.978	cellular process
GO:0010604	0.962	positive regulation of macromolecule metabolic process
GO:0048522	0.949	positive regulation of cellular process
GO:0051173	0.945	positive regulation of nitrogen compound metabolic process
GO:0006357	0.945	regulation of transcription by RNA polymerase II
GO:0045893	0.938	positive regulation of DNA-templated transcription
GO:0032502	0.875	developmental process
GO:0048856	0.872	anatomical structure development
GO:0032501	0.855	multicellular organismal process
GO:0048523	0.664	negative regulation of cellular process
GO:0048731	0.551	system development
GO:0048513	0.521	animal organ development
GO:0010605	0.457	negative regulation of macromolecule metabolic process
GO:0030154	0.442	cell differentiation
GO:0045944	0.394	positive regulation of transcription by RNA polymerase II
GO:0051172	0.383	negative regulation of nitrogen compound metabolic process
GO:0007423	0.381	sensory organ development
GO:0031327	0.380	negative regulation of cellular biosynthetic process
GO:0010558	0.376	negative regulation of macromolecule biosynthetic process
GO:0045892	0.360	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.976	nucleoplasm
GO:0005737	0.655	cytoplasm
GO:0005829	0.445	cytosol
GO:0043232	0.328	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]