StarFunc result for job id Q8N1A0

User Input

>input (295 residues)
MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARR
QWHHLQVEIESLHAVERGLENSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQ
EHEMLLNTKMRLEQEIATYRHLLEKEEIRYYGCIQGGKKDKKPTTSRVGFVLPSAIINEI
SFTTKVPQKYENENVETVTKQAILNGSIVKESTEAHGTIQTEKVDEVIKEWEGSFFKDNP
RLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMRRSCSIPSIKPPSTAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N1A0	1.000	1.000	1.272E-40	295	1.000	1.000	Q8N1A0.pdb.gz	KT222_HUMAN Keratin-like protein KRT222 OS=Homo sapiens OX=9606 GN=KRT222 PE=1 SV=1
2	AFDB:B3DI58	0.442	0.257	2.517E-4	539	0.197	0.108	B3DI58.pdb.gz	B3DI58_DANRE Notochord granular surface OS=Danio rerio OX=7955 GN=ngs PE=1 SV=1
3	AFDB:P02535	0.465	0.249	4.280E-4	570	0.200	0.104	P02535.pdb.gz	K1C10_MOUSE Keratin, type I cytoskeletal 10 OS=Mus musculus OX=10090 GN=Krt10 PE=1 SV=3
4	AFDB:P08779	0.432	0.282	6.374E-4	473	0.207	0.129	P08779.pdb.gz	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
5	AFDB:Q01546	0.457	0.221	3.581E-3	638	0.186	0.086	Q01546.pdb.gz	K22O_HUMAN Keratin, type II cytoskeletal 2 oral OS=Homo sapiens OX=9606 GN=KRT76 PE=1 SV=2
6	AFDB:Q6IFV1	0.497	0.308	3.581E-3	485	0.190	0.115	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
7	AFDB:P13647	0.474	0.251	4.089E-3	590	0.180	0.090	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
8	AFDB:B1AQ75	0.454	0.293	4.670E-3	473	0.193	0.121	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
9	AFDB:P02538	0.471	0.254	5.699E-3	564	0.186	0.098	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
10	AFDB:Q6IFW3	0.447	0.282	5.699E-3	481	0.210	0.129	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
11	PDB:6v22E	0.067	0.091	1.419	199	0.034	0.050	6v22E.pdb.gz	Molecular structures of the human Slo1 K + channel in complex with beta 4.
12	PDB:6w6vG	0.060	0.089	2.258	126	0.024	0.056	6w6vG.pdb.gz	Cryo-EM structure of catalytic ribonucleoprotein complex RNase MRP.
13	PDB:4v60A	0.220	0.095	2.413	812	0.125	0.046	4v60A.pdb.gz
14	PDB:7vtdA	0.077	0.074	3.840	307	0.007	0.007	7vtdA.pdb.gz
15	PDB:4f0aB	0.069	0.070	4.103	294	0.007	0.007	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
16	PDB:5ccxA	0.089	0.092	4.385	283	0.014	0.014	5ccxA.pdb.gz	Crystal Structure of the Human tRNA m(1)A58 Methyltransferase-tRNA3(Lys) Complex: Refolding of Substrate tRNA Allows Access to the Methylation Target.
17	PDB:6s1cB	0.062	0.056	4.385	342	0.024	0.020	6s1cB.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
18	PDB:7p2eH	0.060	0.109	4.686	140	0.031	0.064	7p2eH.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
19	PDB:2ymwB	0.097	0.046	5.007	685	0.010	0.004	2ymwB.pdb.gz
20	PDB:4v6iAJ	0.102	0.214	5.351	112	0.020	0.054	4v6iAJ.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N1A0	0.0	603	295	1.000	1.000	KT222_HUMAN Keratin-like protein KRT222 OS=Homo sapiens OX=9606 GN=KRT222 PE=1 SV=1
2	O76011	8.02e-25	105	436	0.193	0.131	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
3	Q14525	5.68e-23	99.8	404	0.190	0.139	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
4	O76009	5.96e-23	99.8	404	0.190	0.139	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
5	Q61414	7.82e-23	99.8	452	0.200	0.131	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
6	Q15323	9.01e-23	99.4	416	0.186	0.132	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
7	O76013	3.18e-22	98.2	467	0.176	0.111	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
8	P19012	4.80e-22	97.4	456	0.193	0.125	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
9	P08730	2.20e-21	95.5	437	0.190	0.128	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
10	Q6IFV3	3.42e-21	95.1	447	0.190	0.125	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
11	Q9Z2K1	1.18e-20	93.6	469	0.180	0.113	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
12	P19001	1.29e-20	93.2	403	0.183	0.134	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
13	P08779	1.44e-20	93.2	473	0.186	0.116	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
14	P02533	1.95e-20	92.8	472	0.186	0.117	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
15	O76014	2.18e-20	92.8	449	0.186	0.122	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
16	Q92764	2.50e-20	92.4	455	0.197	0.127	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
17	Q14532	2.93e-20	92.4	448	0.169	0.112	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
18	Q6IFV1	3.12e-20	92.4	485	0.183	0.111	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
19	P13646	7.02e-20	91.3	458	0.183	0.118	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
20	O76015	8.03e-20	91.3	456	0.183	0.118	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05549 Allexi_40kDa	46	15.0	Allexivirus 40kDa protein
2	PF05700 BCAS2	1.3e+02	13.7	Breast carcinoma amplified sequence 2 (BCAS2)
3	PF07889 DUF1664	16	17.0	Protein of unknown function (DUF1664)
4	PF00038 Filament	2.5e-25	101.3	Intermediate filament protein
5	PF02841 GBP_C	4.2e+02	11.7	Guanylate-binding protein, C-terminal domain
6	PF09726 Macoilin	11	16.1	Macoilin family
7	PF20592 pAdhesive_10	3.9e+02	12.6	Putative adhesin domain (group 10)
8	PF02358 Trehalose_PPase	2.9e+02	11.9	Trehalose-phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377616

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258975	0.723	Translational activator of cytochrome c oxidase 1
2	9606.ENSP00000360076	0.660	SH3-containing GRB2-like protein 3-interacting protein 1
3	9606.ENSP00000260970	0.635	Peptidyl-prolyl cis-trans isomerase G
4	9606.ENSP00000257663	0.624	Transmembrane protein 60
5	9606.ENSP00000392617	0.616	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
6	9606.ENSP00000323967	0.601	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
7	9606.ENSP00000260102	0.588	Mitochondrial ribosomal protein L15
8	9606.ENSP00000330199	0.536	Sodium-dependent neutral amino acid transporter SLC6A17
9	9606.ENSP00000358312	0.517	Peroxisomal membrane protein 11B
10	9606.ENSP00000380488	0.515	Polypeptide N-acetylgalactosaminyltransferase 9
11	9606.ENSP00000367433	0.513	Adherens junction-associated protein 1
12	9606.ENSP00000286371	0.506	Sodium/potassium-transporting ATPase subunit beta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.649	biological regulation
GO:0050789	0.590	regulation of biological process
GO:0050794	0.483	regulation of cellular process
GO:0071840	0.467	cellular component organization or biogenesis
GO:0016043	0.426	cellular component organization
GO:0032502	0.377	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005737	0.988	cytoplasm
GO:0005829	0.982	cytosol
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005856	0.627	cytoskeleton
GO:0043227	0.586	membrane-bounded organelle
GO:0043231	0.308	intracellular membrane-bounded organelle
GO:0016020	0.301	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]