StarFunc result for job id Q8N1B3

User Input

>input (248 residues)
MEAPEGGGGGPAARGPEGQPAPEARVHFRVARFIMEAGVKLGMRSIPIATACTIYHKFFC
ETNLDAYDPYLIAMSSIYLAGKVEEQHLRTRDIINVSNRYFNPSGEPLELDSRFWELRDS
IVQCELLMLRVLRFQVSFQHPHKYLLHYLVSLQNWLNRHSWQRTPVAVTAWALLRDSYHG
ALCLRFQAQHIAVAVLYLALQVYGVEVPAEVEAEKPWWQVFNDDLTKPIIDNIVSDLIQI
YTMDTEIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N1B3	1.000	1.000	7.508E-35	248	1.000	1.000	Q8N1B3.pdb.gz	CCNQ_HUMAN Cyclin-Q OS=Homo sapiens OX=9606 GN=CCNQ PE=1 SV=2
2	AFDB:Q8QZR8	0.930	0.923	3.167E-30	250	0.891	0.884	Q8QZR8.pdb.gz	CCNQ_MOUSE Cyclin-Q OS=Mus musculus OX=10090 GN=Ccnq PE=2 SV=2
3	AFDB:Q52KE7	0.798	0.379	6.086E-12	532	0.254	0.118	Q52KE7.pdb.gz	CCNL1_MOUSE Cyclin-L1 OS=Mus musculus OX=10090 GN=Ccnl1 PE=1 SV=1
4	AFDB:F1QMB9	0.787	0.467	1.201E-11	425	0.242	0.141	F1QMB9.pdb.gz	CCNK_DANRE Cyclin-K OS=Danio rerio OX=7955 GN=ccnk PE=2 SV=3
5	AFDB:Q8RWV3	0.797	0.482	1.440E-11	416	0.250	0.149	Q8RWV3.pdb.gz	CCL11_ARATH Cyclin-L1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCL1-1 PE=1 SV=2
6	AFDB:Q5I0H5	0.798	0.388	3.111E-11	520	0.254	0.121	Q5I0H5.pdb.gz	CCNL2_RAT Cyclin-L2 OS=Rattus norvegicus OX=10116 GN=Ccnl2 PE=1 SV=2
7	AFDB:Q8GYM6	0.783	0.369	3.902E-11	541	0.234	0.107	Q8GYM6.pdb.gz	CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-4 PE=1 SV=1
8	AFDB:Q961D1	0.751	0.475	4.470E-11	400	0.234	0.145	Q961D1.pdb.gz	Q961D1_DROME Cyclin K, isoform A OS=Drosophila melanogaster OX=7227 GN=CycK PE=1 SV=1
9	AFDB:O60583	0.788	0.277	5.866E-11	730	0.206	0.070	O60583.pdb.gz	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
10	AFDB:Q7TQK0	0.805	0.286	6.423E-11	723	0.202	0.069	Q7TQK0.pdb.gz	CCNT2_MOUSE Cyclin-T2 OS=Mus musculus OX=10090 GN=Ccnt2 PE=1 SV=1
11	PDB:6gzhB	0.797	0.785	7.783E-10	252	0.185	0.183	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
12	PDB:1zp2A	0.639	0.693	1.480E-8	227	0.181	0.198	1zp2A.pdb.gz
13	PDB:5hbhB	0.691	0.638	4.198E-8	270	0.214	0.196	5hbhB.pdb.gz	Discovery of Potent, Selective, and Orally Bioavailable Small-Molecule Modulators of the Mediator Complex-Associated Kinases CDK8 and CDK19.
14	PDB:7kpvB	0.645	0.557	6.911E-8	290	0.190	0.162	7kpvB.pdb.gz
15	PDB:7jv7B	0.701	0.571	8.055E-6	310	0.153	0.123	7jv7B.pdb.gz
16	PDB:7egb9	0.626	0.546	2.390E-5	287	0.141	0.122	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
17	PDB:7kueB	0.557	0.610	7.092E-5	225	0.149	0.164	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
18	PDB:7nj0C	0.619	0.573	7.765E-5	270	0.113	0.104	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
19	PDB:2w96A	0.584	0.582	1.400E-4	249	0.121	0.120	2w96A.pdb.gz
20	PDB:7b5lY	0.633	0.621	1.400E-4	253	0.149	0.146	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N1B3	0.0	518	248	1.000	1.000	CCNQ_HUMAN Cyclin-Q OS=Homo sapiens OX=9606 GN=CCNQ PE=1 SV=2
2	Q8QZR8	1.59e-165	459	250	0.891	0.884	CCNQ_MOUSE Cyclin-Q OS=Mus musculus OX=10090 GN=Ccnq PE=2 SV=2
3	F1QMB9	2.43e-26	107	425	0.254	0.148	CCNK_DANRE Cyclin-K OS=Danio rerio OX=7955 GN=ccnk PE=2 SV=3
4	Q961D1	7.30e-26	106	400	0.250	0.155	Q961D1_DROME Cyclin K, isoform A OS=Drosophila melanogaster OX=7227 GN=CycK PE=1 SV=1
5	G3V5E1	2.41e-25	104	378	0.258	0.169	G3V5E1_HUMAN Cyclin K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=1
6	O88874	3.07e-25	105	554	0.258	0.116	CCNK_MOUSE Cyclin-K OS=Mus musculus OX=10090 GN=Ccnk PE=1 SV=3
7	O75909	4.90e-25	105	580	0.258	0.110	CCNK_HUMAN Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=2
8	Q8RWV3	1.61e-24	102	416	0.266	0.159	CCL11_ARATH Cyclin-L1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCL1-1 PE=1 SV=2
9	Q5I0H5	1.68e-23	100	520	0.266	0.127	CCNL2_RAT Cyclin-L2 OS=Rattus norvegicus OX=10116 GN=Ccnl2 PE=1 SV=2
10	Q9JJA7	1.85e-23	100	518	0.262	0.125	CCNL2_MOUSE Cyclin-L2 OS=Mus musculus OX=10090 GN=Ccnl2 PE=1 SV=1
11	G3V2Q3	1.82e-22	94.0	227	0.226	0.247	G3V2Q3_HUMAN Cyclin K (Fragment) OS=Homo sapiens OX=9606 GN=CCNK PE=1 SV=1
12	Q96S94	3.16e-22	97.1	520	0.254	0.121	CCNL2_HUMAN Cyclin-L2 OS=Homo sapiens OX=9606 GN=CCNL2 PE=1 SV=1
13	Q9UK58	2.38e-21	94.7	526	0.238	0.112	CCNL1_HUMAN Cyclin-L1 OS=Homo sapiens OX=9606 GN=CCNL1 PE=1 SV=1
14	Q8GYM6	2.68e-21	94.4	541	0.234	0.107	CCT14_ARATH Cyclin-T1-4 OS=Arabidopsis thaliana OX=3702 GN=CYCT1-4 PE=1 SV=1
15	Q9R1Q2	2.68e-21	94.4	527	0.238	0.112	CCNL1_RAT Cyclin-L1 OS=Rattus norvegicus OX=10116 GN=Ccnl1 PE=1 SV=1
16	Q52KE7	2.73e-21	94.4	532	0.238	0.111	CCNL1_MOUSE Cyclin-L1 OS=Mus musculus OX=10090 GN=Ccnl1 PE=1 SV=1
17	Q76NM8	3.49e-21	91.7	274	0.278	0.252	Q76NM8_PLAF7 Cyclin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1304700 PE=3 SV=2
18	F4KD43	7.58e-20	90.5	590	0.226	0.095	F4KD43_ARATH Cyclin family protein OS=Arabidopsis thaliana OX=3702 GN=CYCT1:5 PE=1 SV=1
19	O60583	7.03e-18	84.7	730	0.230	0.078	CCNT2_HUMAN Cyclin-T2 OS=Homo sapiens OX=9606 GN=CCNT2 PE=1 SV=2
20	O17869	1.63e-17	81.3	252	0.218	0.214	O17869_CAEEL Cyclin-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ccnk-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00134 Cyclin_N	2e-08	45.5	Cyclin, N-terminal domain
2	PF17193 MukF_C	4.3e+02	12.5	MukF C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000015069

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000017333	0.817	Belongs to the protein kinase superfamily.
2	9544.ENSMMUP00000025456	0.817	Transcription elongation factor SPT5
3	9544.ENSMMUP00000003366	0.799	Cyclin-dependent kinase 10
4	9544.ENSMMUP00000023739	0.769	Uncharacterized protein
5	9544.ENSMMUP00000023740	0.769	Uncharacterized protein
6	9544.ENSMMUP00000028126	0.769	Uncharacterized protein
7	9544.ENSMMUP00000020525	0.760	AF4/FMR2 family, member 4
8	9544.ENSMMUP00000002190	0.735	CDK-activating kinase assembly factor MAT1 isoform 1
9	9544.ENSMMUP00000008172	0.726	General transcription factor IIH polypeptide 2
10	9544.ENSMMUP00000019486	0.726	Cyclin-dependent kinase 8
11	9544.ENSMMUP00000027166	0.726	Cyclin-dependent kinase 19
12	9544.ENSMMUP00000006103	0.722	General transcription factor IIH subunit 3
13	9544.ENSMMUP00000024421	0.721	Uncharacterized protein
14	9544.ENSMMUP00000003141	0.720	Leo1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
15	9544.ENSMMUP00000024483	0.714	Component of the general transcription and DNA repair factor IIH (TFIIH) core complex which is involved in general and transcription-coupled nucleotide excision repair (NER) of damaged DNA.
16	9544.ENSMMUP00000033293	0.707	General transcription factor IIH subunit 5
17	9544.ENSMMUP00000025118	0.700	UBX domain protein 7
18	9544.ENSMMUP00000031094	0.700	DNA-directed RNA polymerase subunit
19	9544.ENSMMUP00000002131	0.699	General transcription factor IIE subunit 1
20	9544.ENSMMUP00000000627	0.681	Transcription initiation factor IIE subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0050794	0.991	regulation of cellular process
GO:0048522	0.905	positive regulation of cellular process
GO:0051726	0.552	regulation of cell cycle
GO:1901987	0.490	regulation of cell cycle phase transition
GO:1902749	0.427	regulation of cell cycle G2/M phase transition
GO:0008284	0.346	positive regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0061695	0.998	transferase complex, transferring phosphorus-containing groups
GO:1902554	0.979	serine/threonine protein kinase complex
GO:0005634	0.958	nucleus
GO:0005654	0.901	nucleoplasm
GO:0000307	0.837	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]