StarFunc result for job id Q8N1F7

User Input

>input (819 residues)
MDTEGFGELLQQAEQLAAETEGISELPHVERNLQEIQQAGERLRSRTLTRTSQETADVKA
SVLLGSRGLDISHISQRLESLSAATTFEPLEPVKDTDIQGFLKNEKDNALLSAIEESRKR
TFGMAEEYHRESMLVEWEQVKQRILHTLLASGEDALDFTQESEPSYISDVGPPGRSSLDN
IEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDMWTMVKQMTDVLLTPATD
ALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLHQAQLGGVPGTYQLVRSFLNIK
LPAPLPGLQDGEVEGHPVWALIYYCMRCGDLLAASQVVNRAQHQLGEFKTWFQEYMNSKD
RRLSPATENKLRLHYRRALRNNTDPYKRAVYCIIGRCDVTDNQSEVADKTEDYLWLKLNQ
VCFDDDGTSSPQDRLTLSQFQKQLLEDYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLF
RMERLRCHAVHVALVLFELKLLLKSSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFE
STDPREALQYFYFLRDEKDSQGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDK
FTSDTKPIINKVASVAENKGLFEEAAKLYDLAKNADKVLELMNKLLSPVVPQISAPQSNK
ERLKNMALSIAERYRAQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLV
PLNQESVEERVAAFRNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIED
RDSQLRSQARTLITFAGMIPYRTSGDTNARLVQMEVLMN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q66HC5	0.950	0.950	7.876E-98	819	0.976	0.976	Q66HC5.pdb.gz	NUP93_RAT Nuclear pore complex protein Nup93 OS=Rattus norvegicus OX=10116 GN=Nup93 PE=1 SV=1
2	PDB:7r5jA0	0.808	0.809	2.257E-92	818	0.999	1.000	7r5jA0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
3	AFDB:Q7ZX96	0.817	0.816	1.929E-88	820	0.851	0.850	Q7ZX96.pdb.gz	NUP93_XENLA Nuclear pore complex protein Nup93 OS=Xenopus laevis OX=8355 GN=nup93 PE=1 SV=1
4	PDB:7vciU	0.713	0.712	3.339E-68	820	0.851	0.850	7vciU.pdb.gz
5	PDB:7wkkC	0.642	0.813	1.361E-55	633	0.651	0.842	7wkkC.pdb.gz
6	PDB:7fikP	0.685	0.934	5.022E-53	593	0.604	0.835	7fikP.pdb.gz
7	PDB:7wkkE	0.636	0.817	4.631E-52	625	0.639	0.837	7wkkE.pdb.gz
8	PDB:5ijnC	0.583	0.725	1.198E-50	636	0.772	0.994	5ijnC.pdb.gz
9	AFDB:Q9XZ06	0.750	0.746	4.094E-45	823	0.349	0.348	Q9XZ06.pdb.gz	NU931_DROME Nuclear pore complex protein Nup93-1 OS=Drosophila melanogaster OX=7227 GN=Nup93-1 PE=1 SV=1
10	AFDB:O94418	0.710	0.685	2.807E-34	851	0.230	0.221	O94418.pdb.gz	MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug87 PE=1 SV=1
11	PDB:7fikp	0.498	0.859	1.357E-32	456	0.470	0.844	7fikp.pdb.gz
12	AFDB:Q9BKT9	0.653	0.677	9.545E-31	787	0.247	0.257	Q9BKT9.pdb.gz	Q9BKT9_CAEEL Nuclear pore protein OS=Caenorhabditis elegans OX=6239 GN=npp-13 PE=1 SV=1
13	AFDB:P34077	0.639	0.625	1.797E-29	839	0.241	0.235	P34077.pdb.gz	NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIC96 PE=1 SV=2
14	AFDB:G0S024	0.592	0.459	3.670E-29	1112	0.236	0.174	G0S024.pdb.gz	NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NIC96 PE=1 SV=1
15	AFDB:O14310	0.544	0.490	1.784E-25	933	0.219	0.192	O14310.pdb.gz	NP106_SCHPO Nucleoporin npp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=npp106 PE=1 SV=1
16	AFDB:Q55GW5	0.609	0.515	1.198E-24	979	0.219	0.183	Q55GW5.pdb.gz	Q55GW5_DICDI Nuclear pore protein OS=Dictyostelium discoideum OX=44689 GN=nup93 PE=3 SV=1
17	AFDB:O22224	0.599	0.573	8.364E-24	861	0.197	0.187	O22224.pdb.gz	NP93A_ARATH Nuclear pore complex protein NUP93A OS=Arabidopsis thaliana OX=3702 GN=NUP93A PE=1 SV=2
18	PDB:7wooZ	0.620	0.675	1.092E-22	746	0.228	0.251	7wooZ.pdb.gz
19	PDB:7n9fR	0.482	0.544	3.262E-13	708	0.221	0.256	7n9fR.pdb.gz
20	PDB:7r5jL0	0.290	0.299	8.325E-5	782	0.107	0.113	7r5jL0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q66HC5	0.0	1668	819	0.976	0.976	NUP93_RAT Nuclear pore complex protein Nup93 OS=Rattus norvegicus OX=10116 GN=Nup93 PE=1 SV=1
2	Q7ZX96	0.0	1448	820	0.851	0.850	NUP93_XENLA Nuclear pore complex protein Nup93 OS=Xenopus laevis OX=8355 GN=nup93 PE=1 SV=1
3	Q8BJ71	0.0	1668	819	0.977	0.977	NUP93_MOUSE Nuclear pore complex protein Nup93 OS=Mus musculus OX=10090 GN=Nup93 PE=1 SV=1
4	Q8N1F7	0.0	1697	819	1.000	1.000	NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93 PE=1 SV=2
5	Q9XZ06	1.49e-152	469	823	0.353	0.351	NU931_DROME Nuclear pore complex protein Nup93-1 OS=Drosophila melanogaster OX=7227 GN=Nup93-1 PE=1 SV=1
6	Q9BKT9	3.33e-60	220	787	0.216	0.225	Q9BKT9_CAEEL Nuclear pore protein OS=Caenorhabditis elegans OX=6239 GN=npp-13 PE=1 SV=1
7	P34077	1.05e-58	217	839	0.266	0.260	NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NIC96 PE=1 SV=2
8	O94418	5.43e-42	167	851	0.265	0.255	MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug87 PE=1 SV=1
9	G0S024	9.47e-41	164	1112	0.193	0.142	NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=NIC96 PE=1 SV=1
10	O22224	9.59e-30	129	861	0.197	0.187	NP93A_ARATH Nuclear pore complex protein NUP93A OS=Arabidopsis thaliana OX=3702 GN=NUP93A PE=1 SV=2
11	F4J284	4.70e-25	114	860	0.215	0.205	NU93B_ARATH Nuclear pore complex protein NUP93B OS=Arabidopsis thaliana OX=3702 GN=NUP93B PE=1 SV=1
12	O14310	1.00e-24	113	933	0.194	0.170	NP106_SCHPO Nucleoporin npp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=npp106 PE=1 SV=1
13	Q55GW5	5.61e-18	91.7	979	0.167	0.140	Q55GW5_DICDI Nuclear pore protein OS=Dictyostelium discoideum OX=44689 GN=nup93 PE=3 SV=1
14	Q38AQ7	0.25	37.4	883	0.115	0.106	Q38AQ7_TRYB2 Nuclear pore protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3670 PE=3 SV=1
15	P60469	0.61	36.2	1194	0.035	0.024	LIPA3_MOUSE Liprin-alpha-3 OS=Mus musculus OX=10090 GN=Ppfia3 PE=1 SV=2
16	O75145	0.62	36.2	1194	0.035	0.024	LIPA3_HUMAN Liprin-alpha-3 OS=Homo sapiens OX=9606 GN=PPFIA3 PE=1 SV=3
17	P87049	2.2	33.9	411	0.031	0.061	CGP1_SCHPO G1/S-specific cyclin pas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pas1 PE=2 SV=3
18	Q3L257	7.3	32.0	245	0.033	0.110	Q3L257_CHICK Protein Wnt (Fragment) OS=Gallus gallus OX=9031 GN=WNT2 PE=2 SV=1
19	P50533	8.6	32.3	1203	0.026	0.017	SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis OX=8355 GN=smc2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00637 Clathrin	2.6e+02	12.9	Region in Clathrin and VPS
2	PF04097 Nic96	5e-189	641.2	Nup93/Nic96
3	PF04121 Nup84_Nup100	11	15.7	Nuclear pore protein 84 / 107

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310668

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231498	0.999	Nuclear pore complex protein Nup155
2	9606.ENSP00000264883	0.999	Nucleoporin p54
3	9606.ENSP00000285968	0.999	Nuclear pore complex protein Nup205
4	9606.ENSP00000295119	0.999	Nucleoporin NUP53
5	9606.ENSP00000361658	0.999	Nucleoporin NUP188 homolog
6	9606.ENSP00000471191	0.999	Nuclear pore glycoprotein p62
7	9606.ENSP00000229179	0.997	Nuclear pore complex protein Nup107
8	9606.ENSP00000316032	0.997	Nuclear pore complex protein Nup98-Nup96
9	9606.ENSP00000444029	0.996	Nuclear pore complex protein Nup153
10	9606.ENSP00000382779	0.994	Nucleoporin SEH1
11	9606.ENSP00000371155	0.988	Nucleoporin p58/p45
12	9606.ENSP00000261396	0.986	Nuclear pore complex protein Nup133
13	9606.ENSP00000308622	0.985	Nucleoporin GLE1
14	9606.ENSP00000245544	0.983	Nuclear pore complex protein Nup85
15	9606.ENSP00000352400	0.982	Nuclear pore complex protein Nup214
16	9606.ENSP00000379182	0.982	mRNA export factor
17	9606.ENSP00000360483	0.980	Nucleoporin NDC1
18	9606.ENSP00000342262	0.975	Nucleoporin Nup43
19	9606.ENSP00000356448	0.973	Nucleoprotein TPR
20	9606.ENSP00000283195	0.971	E3 SUMO-protein ligase RanBP2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017056	0.998	structural constituent of nuclear pore

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0050794	0.988	regulation of cellular process
GO:0048518	0.988	positive regulation of biological process
GO:0009966	0.976	regulation of signal transduction
GO:0048522	0.972	positive regulation of cellular process
GO:0007165	0.966	signal transduction
GO:0009967	0.932	positive regulation of signal transduction
GO:0035556	0.929	intracellular signal transduction
GO:0090092	0.925	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1902531	0.921	regulation of intracellular signal transduction
GO:0007178	0.918	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0016043	0.909	cellular component organization
GO:0060395	0.904	SMAD protein signal transduction
GO:0090100	0.871	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006996	0.829	organelle organization
GO:0022607	0.665	cellular component assembly
GO:0043933	0.624	protein-containing complex organization
GO:1902533	0.441	positive regulation of intracellular signal transduction
GO:0065003	0.388	protein-containing complex assembly
GO:0051179	0.376	localization
GO:0051641	0.372	cellular localization
GO:0051234	0.359	establishment of localization
GO:0051649	0.339	establishment of localization in cell
GO:0006810	0.338	transport
GO:0006997	0.311	nucleus organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005829	0.997	cytosol
GO:0005635	0.997	nuclear envelope
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0016020	0.993	membrane
GO:0032991	0.990	protein-containing complex
GO:0005654	0.965	nucleoplasm
GO:0140513	0.927	nuclear protein-containing complex
GO:0031090	0.720	organelle membrane
GO:0005643	0.400	nuclear pore
GO:0034399	0.386	nuclear periphery
GO:0031965	0.353	nuclear membrane
GO:0005856	0.320	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]