StarFunc result for job id Q8N1F8

User Input

>input (1088 residues)
MTTAQRDSLLWKLAGLLRESGDVVLSGCSTLSLLTPTLQQLNHVFELHLGPWGPGQTGFV
ALPSHPADSPVILQLQFLFDVLQKTLSLKLVHVAGPGPTGPIKIFPFKSLRHLELRGVPL
HCLHGLRGIYSQLETLICSRSLQALEELLSACGGDFCSALPWLALLSANFSYNALTALDS
SLRLLSALRFLNLSHNQVQDCQGFLMDLCELHHLDISYNRLHLVPRMGPSGAALGVLILR
GNELRSLHGLEQLRNLRHLDLAYNLLEGHRELSPLWLLAELRKLYLEGNPLWFHPEHRAA
TAQYLSPRARDAATGFLLDGKVLSLTDFQTHTSLGLSPMGPPLPWPVGSTPETSGGPDLS
DSLSSGGVVTQPLLHKVKSRVRVRRASISEPSDTDPEPRTLNPSPAGWFVQQHPELELMS
SFRERFGRNWLQYRSHLEPSGNPLPATPTTSAPSAPPASSQGPDTAPRPSPPQEEARGPQ
ESPQKMSEEVRAEPQEEEEEKEGKEEKEEGEMVEQGEEEAGEEEEEEQDQKEVEAELCRP
LLVCPLEGPEGVRGRECFLRVTSAHLFEVELQAARTLERLELQSLEAAEIEPEAQAQRSP
RPTGSDLLPGAPILSLRFSYICPDRQLRRYLVLEPDAHAAVQELLAVLTPVTNVAREQLG
EARDLLLGRFQCLRCGHEFKPEEPRMGLDSEEGWRPLFQKTESPAVCPNCGSDHVVLLAV
SRGTPNRERKQGEQSLAPSPSASPVCHPPGHGDHLDRAKNSPPQAPSTRDHGSWSLSPPP
ERCGLRSVDHRLRLFLDVEVFSDAQEEFQCCLKVPVALAGHTGEFMCLVVVSDRRLYLLK
VTGEMREPPASWLQLTLAVPLQDLSGIELGLAGQSLRLEWAAGAGRCVLLPRDARHCRAF
LEELLDVLQSLPPAWRNCVSATEEEVTPQHRLWPLLEKDSSLEARQFFYLRAFLVEGPST
CLVSLLLTPSTLFLLDEDAAGSPAEPSPPAASGEASEKVPPSGPGPAVRVREQQPLSSLS
SVLLYRSAPEDLRLLFYDEVSRLESFWALRVVCQEQLTALLAWIREPWEELFSIGLRTVI
QEALALDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N1F8	1.000	1.000	0.000	1088	1.000	1.000	Q8N1F8.pdb.gz	S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens OX=9606 GN=STK11IP PE=1 SV=4
2	AFDB:Q14160	0.169	0.118	1.446E-11	1630	0.168	0.112	Q14160.pdb.gz	SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=5
3	AFDB:Q80U72	0.170	0.119	5.495E-11	1612	0.149	0.100	Q80U72.pdb.gz	SCRIB_MOUSE Protein scribble homolog OS=Mus musculus OX=10090 GN=Scrib PE=1 SV=2
4	AFDB:Q9VGI1	0.193	0.157	3.378E-10	1354	0.115	0.092	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
5	PDB:6hkwA	0.165	0.465	5.908E-10	306	0.053	0.190	6hkwA.pdb.gz
6	PDB:7p5vB	0.172	0.249	1.002E-8	732	0.051	0.075	7p5vB.pdb.gz
7	PDB:7tvfD	0.160	0.310	1.448E-7	515	0.050	0.105	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
8	AFDB:O35930	0.130	0.185	5.974E-7	734	0.113	0.168	O35930.pdb.gz	GP1BA_MOUSE Platelet glycoprotein Ib alpha chain OS=Mus musculus OX=10090 GN=Gp1ba PE=1 SV=2
9	AFDB:Q80TH2	0.146	0.117	1.648E-6	1402	0.115	0.089	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
10	AFDB:P38800	0.083	0.069	4.311E-6	1345	0.085	0.069	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
11	PDB:7a5pW	0.106	0.605	8.851E-6	174	0.030	0.190	7a5pW.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.
12	PDB:6gffI	0.127	0.231	1.039E-5	551	0.052	0.103	6gffI.pdb.gz
13	AFDB:M0R9T2	0.119	0.105	1.324E-5	1258	0.097	0.084	M0R9T2.pdb.gz	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
14	PDB:6xtbE	0.083	0.334	1.357E-5	235	0.025	0.115	6xtbE.pdb.gz
15	PDB:2ft3F	0.122	0.387	2.717E-5	305	0.033	0.118	2ft3F.pdb.gz
16	PDB:6m04A	0.152	0.218	4.166E-5	714	0.044	0.067	6m04A.pdb.gz
17	AFDB:Q9LJ64	0.130	0.147	4.521E-5	956	0.098	0.112	Q9LJ64.pdb.gz	PLRX1_ARATH Pollen-specific leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=PEX1 PE=1 SV=1
18	PDB:6g90W	0.109	0.651	5.158E-5	170	0.027	0.171	6g90W.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
19	PDB:7nkyQ	0.084	0.192	7.497E-5	404	0.028	0.074	7nkyQ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	AFDB:Q1X8D7	0.095	0.134	2.635E-4	754	0.080	0.115	Q1X8D7.pdb.gz	LRC36_HUMAN Leucine-rich repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=LRRC36 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DKM2	0.0	748	396	0.344	0.944	B4DKM2_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q8N1F8	0.0	2166	1088	1.000	1.000	S11IP_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens OX=9606 GN=STK11IP PE=1 SV=4
3	M0QYE5	5.46e-49	170	96	0.075	0.854	M0QYE5_HUMAN Serine/threonine kinase 11 interacting protein (Fragment) OS=Homo sapiens OX=9606 GN=STK11IP PE=1 SV=1
4	C9J715	1.57e-18	93.2	583	0.080	0.149	C9J715_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=1
5	Q9Y2I1	1.82e-18	94.0	1504	0.080	0.058	NISCH_HUMAN Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=3
6	Q80TM9	7.79e-18	92.0	1593	0.069	0.047	NISCH_MOUSE Nischarin OS=Mus musculus OX=10090 GN=Nisch PE=1 SV=2
7	Q4G017	2.08e-17	90.5	1502	0.069	0.050	NISCH_RAT Nischarin OS=Rattus norvegicus OX=10116 GN=Nisch PE=2 SV=2
8	Q8VYG9	2.97e-08	60.1	499	0.040	0.086	PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana OX=3702 GN=PIRL9 PE=2 SV=1
9	Q9XHH2	4.65e-07	53.9	198	0.035	0.192	DNAL1_CHLRE Dynein axonemal light chain 1 OS=Chlamydomonas reinhardtii OX=3055 GN=LC1 PE=1 SV=1
10	Q96M69	5.09e-07	56.6	825	0.060	0.079	LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens OX=9606 GN=LRGUK PE=1 SV=1
11	Q8GUJ5	1.24e-06	55.1	677	0.044	0.071	Q8GUJ5_ARATH At4g03260 OS=Arabidopsis thaliana OX=3702 GN=MASP1 PE=1 SV=1
12	Q9UQ13	1.40e-06	54.7	582	0.051	0.096	SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens OX=9606 GN=SHOC2 PE=1 SV=2
13	Q9H9A6	2.84e-06	53.9	602	0.033	0.060	LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens OX=9606 GN=LRRC40 PE=1 SV=1
14	X6RI37	4.07e-06	51.2	221	0.047	0.231	X6RI37_HUMAN SHOC2 leucine rich repeat scaffold protein OS=Homo sapiens OX=9606 GN=SHOC2 PE=1 SV=2
15	Q7Z7A1	4.90e-06	53.5	2325	0.034	0.016	CNTRL_HUMAN Centriolin OS=Homo sapiens OX=9606 GN=CNTRL PE=1 SV=2
16	P71451	6.19e-06	51.6	297	0.036	0.131	INLC_LISMG Internalin C OS=Listeria monocytogenes serotype 1/2a (strain EGD / Mackaness) OX=1334565 GN=inlC PE=1 SV=1
17	A2AL36	1.17e-05	52.4	2334	0.028	0.013	CNTRL_MOUSE Centriolin OS=Mus musculus OX=10090 GN=Cntrl PE=1 SV=2
18	Q380Y7	2.03e-05	51.2	1004	0.040	0.043	Q380Y7_TRYB2 AMP-activated protein kinase glycogen-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8770 PE=4 SV=1
19	F4IA60	4.95e-05	49.7	681	0.037	0.059	F4IA60_ARATH Outer arm dynein light chain 1 protein OS=Arabidopsis thaliana OX=3702 GN=At1g78230 PE=1 SV=1
20	Q9FFJ3	5.58e-05	49.7	506	0.035	0.075	PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana OX=3702 GN=PIRL1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01155 HypA	1.9e+02	13.5	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
2	PF15904 LIP1	7.4e-30	114.4	LKB1 serine/threonine kinase interacting protein 1
3	PF00560 LRR_1	2.9	19.6	Leucine Rich Repeat
4	PF12799 LRR_4	7.7e-05	34.2	Leucine Rich repeats (2 copies)
5	PF13516 LRR_6	4e+02	12.6	Leucine Rich repeat
6	PF13855 LRR_8	2.7e-06	38.3	Leucine rich repeat
7	PF09723 Zn-ribbon_8	11	17.6	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295641

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324856	0.973	Serine/threonine-protein kinase STK11
2	9606.ENSP00000341551	0.970	Mothers against decapentaplegic homolog 4
3	9606.ENSP00000388713	0.642	LanC-like protein 1
4	9606.ENSP00000366487	0.634	ADP-ribosylation factor-like protein 5B
5	9606.ENSP00000295087	0.554	ADP-ribosylation factor-like protein 5A
6	9606.ENSP00000262644	0.549	Inositol monophosphatase 3
7	9606.ENSP00000363624	0.549	Protein CutA
8	9606.ENSP00000307640	0.545	Tetratricopeptide repeat domain containing
9	9606.ENSP00000258418	0.525	Calcium-binding protein 39
10	9606.ENSP00000272217	0.504	ADP-ribosylation factor-like protein 8A
11	9606.ENSP00000381072	0.504	Serpin B8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0051641	0.982	cellular localization
GO:0008104	0.959	protein localization
GO:0065007	0.586	biological regulation
GO:0050789	0.561	regulation of biological process
GO:0008152	0.445	metabolic process
GO:0050794	0.371	regulation of cellular process
GO:0071704	0.359	organic substance metabolic process
GO:0050896	0.333	response to stimulus
GO:0044238	0.305	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	1.000	intracellular organelle lumen
GO:0031090	0.997	organelle membrane
GO:0012505	0.996	endomembrane system
GO:0005576	0.996	extracellular region
GO:0031982	0.994	vesicle
GO:0005765	0.991	lysosomal membrane
GO:0005634	0.972	nucleus
GO:0031410	0.962	cytoplasmic vesicle
GO:0005829	0.944	cytosol
GO:0030141	0.931	secretory granule
GO:0005766	0.926	primary lysosome
GO:0042582	0.914	azurophil granule
GO:0031983	0.913	vesicle lumen
GO:0031981	0.913	nuclear lumen
GO:0005775	0.901	vacuolar lumen
GO:0034774	0.895	secretory granule lumen
GO:0035578	0.808	azurophil granule lumen
GO:0005615	0.619	extracellular space
GO:0005654	0.524	nucleoplasm
GO:0070062	0.480	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]