StarFunc result for job id Q8N1G0

User Input

>input (1237 residues)
MGDMKTPDFDDLLAAFDIPDIDANEAIHSGPEENEGPGGPGKPEPGVGSESEDTAAASAG
DGPGVPAQASDHGLPPPDISVVSVIVKNTVCPEQSEALAGGSAGDGAQAAGVTKEGPVGP
HRMQNGFGSPEPSLPGTPHSPAPPSGGTWKEKGMEGKTPLDLFAHFGPEPGDHSDPLPPS
APSPTREGALTPPPFPSSFELAQENGPGMQPPVSSPPLGALKQESCSPHHPQVLAQQGSG
SSPKATDIPASASPPPVAGVPFFKQSPGHQSPLASPKVPVCQPLKEEDDDEGPVDKSSPG
SPQSPSSGAEAADEDSNDSPASSSSRPLKVRIKTIKTSCGNITRTVTQVPSDPDPPAPLA
EGAFLAEASLLKLSPATPTSEGPKVVSVQLGDGTRLKGTVLPVATIQNASTAMLMAASVA
RKAVVLPGGTATSPKMIAKNVLGLVPQALPKADGRAGLGTGGQKVNGASVVMVQPSKTAT
GPSTGGGTVISRTQSSLVEAFNKILNSKNLLPAYRPNLSPPAEAGLALPPTGYRCLECGD
AFSLEKSLARHYDRRSMRIEVTCNHCARRLVFFNKCSLLLHAREHKDKGLVMQCSHLVMR
PVALDQMVGQPDITPLLPVAVPPVSGPLALPALGKGEGAITSSAITTVAAEAPVLPLSTE
PPAAPATSAYTCFRCLECKEQCRDKAGMAAHFQQLGPPAPGATSNVCPTCPMMLPNRCSF
SAHQRMHKNRPPHVCPECGGNFLQANFQTHLREACLHVSRRVGYRCPSCSVVFGGVNSIK
SHIQTSHCEVFHKCPICPMAFKSGPSAHAHLYSQHPSFQTQQAKLIYKCAMCDTVFTHKP
LLSSHFDQHLLPQRVSVFKCPSCPLLFAQKRTMLEHLKNTHQSGRLEETAGKGAGGALLT
PKTEPEELAVSQGGAAPATEESSSSSEEEEVPSSPEPPRPAKRPRRELGSKGLKGGGGGP
GGWTCGLCHSWFPERDEYVAHMKKEHGKSVKKFPCRLCERSFCSAPSLRRHVRVNHEGIK
RVYPCRYCTEGKRTFSSRLILEKHVQVRHGLQLGAQSPGRGTTLARGSSARAQGPGRKRR
QSSDSCSEEPDSTTPPAKSPRGGPGSGGHGPLRYRSSSSTEQSLMMGLRVEDGAQQCLDC
GLCFASPGSLSRHRFISHKKRRGVGKASALGLGDGEEEAPPSRSDPDGGDSPLPASGGPL
TCKVCGKSCDSPLNLKTHFRTHGMAFIRARQGAVGDN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N1G0	1.000	1.000	0.000	1237	1.000	1.000	Q8N1G0.pdb.gz	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
2	AFDB:Q9ULJ3	0.051	0.057	9.942E-14	1066	0.138	0.160	Q9ULJ3.pdb.gz	ZBT21_HUMAN Zinc finger and BTB domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZBTB21 PE=1 SV=2
3	AFDB:M9NEG1	0.057	0.062	7.118E-7	1109	0.127	0.142	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
4	AFDB:Q5BIH1	0.041	0.057	6.900E-6	803	0.129	0.198	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
5	AFDB:Q93073	0.045	0.041	5.299E-5	1101	0.135	0.152	Q93073.pdb.gz	SBP2L_HUMAN Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L PE=1 SV=3
6	AFDB:A0A5K4F1D0	0.047	0.031	1.130E-4	2566	0.167	0.081	A0A5K4F1D0.pdb.gz	GLI1_SCHMA Zinc finger protein GLI1 OS=Schistosoma mansoni OX=6183 GN=gli1 PE=2 SV=1
7	AFDB:Q8SY33	0.048	0.044	1.346E-4	1384	0.136	0.121	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
8	AFDB:A0A0K3AUE4	0.052	0.033	2.273E-4	1968	0.161	0.101	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
9	AFDB:A0A0B4KFQ4	0.042	0.043	2.553E-4	1133	0.142	0.155	A0A0B4KFQ4.pdb.gz	A0A0B4KFQ4_DROME Alhambra, isoform O OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
10	AFDB:Q9DB00	0.046	0.031	5.137E-4	2260	0.154	0.085	Q9DB00.pdb.gz	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
11	PDB:3w5kB	0.030	0.233	1.129E-1	110	0.018	0.200	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5c5jF	0.030	0.085	1.094	342	0.010	0.035	5c5jF.pdb.gz	Reactive Oxygen Species Play an Important Role in the Bactericidal Activity of Quinolone Antibiotics
13	PDB:5ln3U	0.031	0.094	1.959	272	0.011	0.051	5ln3U.pdb.gz	Molecular Details Underlying Dynamic Structures and Regulation of the Human 26S Proteasome.
14	PDB:6f40P	0.034	0.104	3.718	246	0.014	0.069	6f40P.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
15	PDB:7oniR	0.034	0.289	4.178	86	0.006	0.093	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:1jeqA	0.024	0.039	4.428	548	0.008	0.018	1jeqA.pdb.gz
17	PDB:5jabA	0.021	0.105	4.428	135	0.006	0.059	5jabA.pdb.gz	Rv2074 is a novel F420 H2 -dependent biliverdin reductase in Mycobacterium tuberculosis.
18	PDB:7tbwA	0.032	0.022	4.694	1928	0.007	0.005	7tbwA.pdb.gz	Cholesterol efflux mechanism revealed by structural analysis of human ABCA1 conformational states.
19	PDB:2le2A	0.031	0.336	5.274	56	0.005	0.107	2le2A.pdb.gz
20	PDB:2yboA	0.031	0.125	5.274	248	0.006	0.032	2yboA.pdb.gz	Crystal Structure of the Heme D1 Biosynthesis Enzyme Nire in Complex with its Substrate Reveals New Insights Into the Catalytic Mechanism of S-Adenosyl-L-Methionine-Dependent Uroporphyrinogen III Methyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N1G0	0.0	2492	1237	1.000	1.000	ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1
2	Q9HCE3	0.0	652	1301	0.334	0.317	ZN532_HUMAN Zinc finger protein 532 OS=Homo sapiens OX=9606 GN=ZNF532 PE=1 SV=2
3	Q92610	9.42e-154	496	1267	0.285	0.279	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
4	J3KTI4	3.20e-15	83.6	1091	0.081	0.092	J3KTI4_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
5	Q96K83	4.58e-15	83.2	1311	0.077	0.072	ZN521_HUMAN Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1
6	Q6KAS7	6.76e-15	82.8	1311	0.076	0.072	ZN521_MOUSE Zinc finger protein 521 OS=Mus musculus OX=10090 GN=Znf521 PE=1 SV=2
7	O95625	3.75e-13	76.6	1053	0.076	0.089	ZBT11_HUMAN Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2
8	E7FAN3	1.62e-12	74.3	764	0.042	0.068	E7FAN3_DANRE Zinc finger protein 408 OS=Danio rerio OX=7955 GN=znf408 PE=4 SV=1
9	E9Q8T2	2.78e-12	73.9	1174	0.078	0.083	PRD15_MOUSE PR domain zinc finger protein 15 OS=Mus musculus OX=10090 GN=Prdm15 PE=1 SV=1
10	P57071	4.38e-12	73.6	1507	0.067	0.055	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
11	Q9H9D4	4.42e-12	73.2	720	0.038	0.065	ZN408_HUMAN Zinc finger protein 408 OS=Homo sapiens OX=9606 GN=ZNF408 PE=1 SV=1
12	Q86WZ6	6.22e-12	72.8	799	0.103	0.159	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
13	Q9P2J8	6.96e-12	72.4	865	0.070	0.099	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
14	Q3ZCT1	7.69e-12	71.2	412	0.075	0.226	ZN260_HUMAN Zinc finger protein 260 OS=Homo sapiens OX=9606 GN=ZNF260 PE=1 SV=3
15	Q5EBL2	9.61e-12	72.4	1059	0.053	0.062	ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens OX=9606 GN=ZNF628 PE=1 SV=3
16	O61360	9.96e-12	72.0	962	0.072	0.093	O61360_DROME CROL ALPHA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
17	Q8BHZ4	1.09e-11	72.0	1262	0.042	0.041	ZN592_MOUSE Zinc finger protein 592 OS=Mus musculus OX=10090 GN=Znf592 PE=1 SV=3
18	O61361	1.19e-11	71.6	891	0.072	0.100	O61361_DROME CROL BETA OS=Drosophila melanogaster OX=7227 GN=crol PE=1 SV=1
19	O08961	1.37e-11	71.6	1311	0.076	0.072	ZN423_RAT Zinc finger protein 423 OS=Rattus norvegicus OX=10116 GN=Znf423 PE=1 SV=2
20	M9PF60	1.94e-11	70.5	571	0.068	0.147	M9PF60_DROME Meiotic central spindle, isoform B OS=Drosophila melanogaster OX=7227 GN=Meics PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	4.3e-11	53.8	Zinc finger, C2H2 type
2	PF16622 zf-C2H2_11	1.3e-14	64.9	zinc-finger C2H2-type
3	PF18868 zf-C2H2_3rep	19	17.4	Zinc finger C2H2-type, 3 repeats
4	PF13894 zf-C2H2_4	1.7e-14	64.2	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	5.3e+02	12.3	Zinc-finger double-stranded RNA-binding
6	PF13465 zf-H2C2_2	12	17.7	Zinc-finger double domain
7	PF12874 zf-met	1.2	20.8	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319829

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000420095	0.962	Protein kinase C-binding protein 1
2	9606.ENSP00000408108	0.846	WD repeat-containing protein 26
3	9606.ENSP00000323687	0.829	(E3-independent) E2 ubiquitin-conjugating enzyme
4	9606.ENSP00000364591	0.789	Testis-specific Y-encoded-like protein 2
5	9606.ENSP00000452877	0.752	Zinc finger protein 592
6	9606.ENSP00000364550	0.728	Lysine-specific demethylase 5C
7	9606.ENSP00000353463	0.691	Transcriptional repressor p66-alpha
8	9606.ENSP00000302913	0.653	SH3 domain-containing protein 19
9	9606.ENSP00000362918	0.646	YTH domain-containing family protein 2
10	9606.ENSP00000296503	0.569	High mobility group protein B2
11	9606.ENSP00000420477	0.562	NAC-alpha domain-containing protein 1
12	9606.ENSP00000251808	0.551	Grainyhead-like protein 2 homolog
13	9606.ENSP00000415151	0.551	Core-binding factor subunit beta
14	9606.ENSP00000268679	0.544	Protein CBFA2T3
15	9606.ENSP00000262506	0.541	Casein kinase II subunit alpha
16	9606.ENSP00000420213	0.527	Filamin-B
17	9606.ENSP00000362649	0.520	Histone deacetylase 1
18	9606.ENSP00000300305	0.510	Runt-related transcription factor 1
19	9606.ENSP00000284292	0.508	Neurogranin
20	9606.ENSP00000264674	0.503	MDS1 and EVI1 complex locus protein EVI1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.438	heterocyclic compound binding
GO:0003676	0.433	nucleic acid binding
GO:0003677	0.390	DNA binding
GO:0140110	0.372	transcription regulator activity
GO:0043565	0.312	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0080090	0.959	regulation of primary metabolic process
GO:0060255	0.954	regulation of macromolecule metabolic process
GO:0051171	0.892	regulation of nitrogen compound metabolic process
GO:0031323	0.883	regulation of cellular metabolic process
GO:0010468	0.799	regulation of gene expression
GO:0048519	0.796	negative regulation of biological process
GO:0051252	0.718	regulation of RNA metabolic process
GO:0010556	0.717	regulation of macromolecule biosynthetic process
GO:0031326	0.717	regulation of cellular biosynthetic process
GO:0006355	0.694	regulation of DNA-templated transcription
GO:0048523	0.693	negative regulation of cellular process
GO:0009987	0.651	cellular process
GO:0009892	0.365	negative regulation of metabolic process
GO:0010605	0.363	negative regulation of macromolecule metabolic process
GO:0048518	0.341	positive regulation of biological process
GO:0031324	0.308	negative regulation of cellular metabolic process
GO:0051172	0.303	negative regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.998	cytoplasm
GO:0005829	0.992	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]