StarFunc result for job id Q8N1G1

User Input

>input (1221 residues)
MLRSTGFFRAIDCPYWSGAPGGPCRRPYCHFRHRGARGSGAPGDGGEAPPAAGLGYDPYN
PELPKPPAQRENGTLGLGEEPRPDVLELELVNQAIEAVRSEVELEQRRYRELLETTREHR
SAEAPALAPRGPNASPTVGPDEDAFPLAFDYSPGSHGLLSPDAGYQPTPLAAPAEPGSKY
SLASLDRGQGRGGGGGGALEYVPKAVSQPRRHSRPVPSGKYVVDNSRPPTDLEYDPLSNY
SARHLSRASSRDERAAKRPRGSRGSEPYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNE
PTTASTPKARADPEIKATGQPPSKEGLEAEGGGLRETKETAVQCDVGDLQPPPAKPASPA
QVQSSQDGGCPKEGKPKKKKTGAPPAPSCKDGAQGKDKTKDKGRGRPVEKPRADKKGPQA
SSPRRKAERPEGTKKKPSSATPVATSGKGRPDRPARRPSPTSGDSRPAAGRGPPRPLQLP
DRKSTKAPSGKLVERKARSLDEGASQDAPKLKKRALSHADLFGDESEDEAAGPGVPSVWP
SALPSLSSDSDSDSDSSLGFPEAQGPPKRLKASPPPSPAPSSSSSSSSSTSSAGADVDYS
ALEKEVDFDSDPMEECLRIFNESTSVKTEDRGRLARQPPKEEKSEEKGLSGLTTLFPGQK
RRISHLSKQGQEVEPPRRGPAVPPARPPTAQEVCYLRAQQAQRASASLLQAPARLAEKSP
SVHISAPGEKRRIAHIPNPRLAAAPTGAKRTLAASGSQSSNGPEPGGQQLKTRTLSGMAS
KTTTTIIPKRIAHSPSLQSLKKPIIPKEFGGKVPTVIRQRYLNLFIEECLKFCTSNQEAI
EKALNEEKVAYDRSPSKNIYLNVAVNTLKKLRGLAPSAVPGLSKTSGRRVVSHEVVLGGR
LAAKTSFSLSRPSSPRVEDLKGAALYSRLREYLLTQDQLKENGYPFPHPERPGGAIIFTA
EEKRPKDSSCRTCCRCGTEYLVSSSGRCIRDEECYYHWGRLRRNRVAGGWETQYMCCSAA
AGSVGCQVAKQHVQDGRKERLEGFVKTFEKELSGDTHPGIYALDCEMSYTTYGLELTRVT
VVDTDVHVVYDTFVKPDNEIVDYNTRFSGVTEADLADTSVTLRDVQAVLLSMFSADTILI
GHSLESDLLALKVIHSTVVDTSVLFPHRLGLPYKRSLRNLMADYLRQIIQDNVDGHSSSE
DAGACMHLVIWKVREDAKTKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N1G1	1.000	1.000	0.000	1221	1.000	1.000	Q8N1G1.pdb.gz	REXO1_HUMAN RNA exonuclease 1 homolog OS=Homo sapiens OX=9606 GN=REXO1 PE=1 SV=3
2	AFDB:Q10124	0.301	0.229	5.088E-33	1647	0.219	0.163	Q10124.pdb.gz	PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans OX=6239 GN=pqe-1 PE=2 SV=2
3	PDB:1wljA	0.120	0.833	4.953E-13	168	0.044	0.321	1wljA.pdb.gz	Crystal structure of human ISG20, an interferon-induced antiviral ribonuclease
4	PDB:5z9xA	0.117	0.478	1.185E-12	288	0.048	0.205	5z9xA.pdb.gz	Structural and biochemical insights into small RNA 3' end trimming by Arabidopsis SDN1.
5	PDB:6r5kA	0.120	0.140	4.511E-7	1040	0.038	0.044	6r5kA.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
6	AFDB:Q9VGI1	0.042	0.040	2.383E-3	1354	0.117	0.106	Q9VGI1.pdb.gz	Q9VGI1_DROME FI23955p1 OS=Drosophila melanogaster OX=7227 GN=prd1 PE=2 SV=1
7	AFDB:Q8SY33	0.033	0.031	6.404E-3	1384	0.124	0.109	Q8SY33.pdb.gz	GAWKY_DROME Protein Gawky OS=Drosophila melanogaster OX=7227 GN=gw PE=1 SV=1
8	PDB:4hecB	0.088	0.490	8.852E-3	163	0.017	0.129	4hecB.pdb.gz	Mycobacterium tuberculosis Rv2179c Protein Establishes a New Exoribonuclease Family with Broad Phylogenetic Distribution.
9	AFDB:P97837	0.043	0.048	3.078E-2	1059	0.112	0.129	P97837.pdb.gz	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
10	AFDB:Q8IRB5	0.048	0.041	4.624E-2	1465	0.118	0.098	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
11	AFDB:Q9XER9	0.038	0.036	8.271E-2	1392	0.124	0.109	Q9XER9.pdb.gz	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
12	AFDB:B1AR10	0.037	0.039	9.291E-2	1109	0.128	0.141	B1AR10.pdb.gz	B1AR10_MOUSE Myeloid/lymphoid or mixed-lineage leukemia; translocated to, 6 OS=Mus musculus OX=10090 GN=Mllt6 PE=1 SV=1
13	AFDB:Q86NP2	0.047	0.046	9.291E-2	1251	0.141	0.137	Q86NP2.pdb.gz	NELFA_DROME Negative elongation factor A OS=Drosophila melanogaster OX=7227 GN=Nelf-A PE=1 SV=2
14	AFDB:A0A0B4K6G3	0.057	0.041	9.847E-2	2018	0.158	0.096	A0A0B4K6G3.pdb.gz	A0A0B4K6G3_DROME Protein partner of snf, isoform B OS=Drosophila melanogaster OX=7227 GN=pps PE=1 SV=1
15	PDB:2oyqA	0.093	0.127	2.434E-1	848	0.031	0.045	2oyqA.pdb.gz	Caught bending the a-rule: crystal structures of translesion DNA synthesis with a non-natural nucleotide.
16	PDB:4xgcE	0.048	0.132	2.735E-1	402	0.019	0.057	4xgcE.pdb.gz	Crystal structure of the eukaryotic origin recognition complex.
17	PDB:2pyjB	0.077	0.149	4.354E-1	572	0.016	0.033	2pyjB.pdb.gz	Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
18	PDB:6v93A	0.094	0.092	6.541E-1	1259	0.036	0.035	6v93A.pdb.gz	Structure and mechanism of B-family DNA polymerase zeta specialized for translesion DNA synthesis.
19	PDB:6mzcK	0.036	0.137	7.788E-1	202	0.016	0.099	6mzcK.pdb.gz
20	PDB:6iczA	0.052	0.036	9.272E-1	2253	0.025	0.013	6iczA.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8IX06	0.0	707	675	0.295	0.533	GOR_HUMAN Putative exonuclease GOR OS=Homo sapiens OX=9606 GN=REXO1L1P PE=5 SV=2
2	Q8N1G1	0.0	2464	1221	1.000	1.000	REXO1_HUMAN RNA exonuclease 1 homolog OS=Homo sapiens OX=9606 GN=REXO1 PE=1 SV=3
3	Q8IRW9	8.11e-58	216	742	0.091	0.150	Q8IRW9_DROME Prage, isoform D OS=Drosophila melanogaster OX=7227 GN=prage PE=4 SV=1
4	C7LAE5	1.58e-57	217	852	0.091	0.130	C7LAE5_DROME IP20073p OS=Drosophila melanogaster OX=7227 GN=prage PE=2 SV=1
5	Q960E5	1.63e-57	215	757	0.091	0.147	Q960E5_DROME SD04906p OS=Drosophila melanogaster OX=7227 GN=prage PE=2 SV=1
6	Q9W557	1.66e-57	215	761	0.091	0.146	Q9W557_DROME Prage, isoform A OS=Drosophila melanogaster OX=7227 GN=prage PE=4 SV=2
7	O76875	1.80e-57	210	515	0.092	0.217	O76875_DROME EG:131F2.2 protein OS=Drosophila melanogaster OX=7227 GN=prage PE=4 SV=1
8	Q8T023	3.28e-57	215	787	0.091	0.141	Q8T023_DROME LD38414p OS=Drosophila melanogaster OX=7227 GN=prage PE=2 SV=1
9	Q10124	1.64e-49	195	1647	0.117	0.087	PQE1_CAEEL Putative RNA exonuclease pqe-1 OS=Caenorhabditis elegans OX=6239 GN=pqe-1 PE=2 SV=2
10	Q9P7H2	2.57e-37	150	540	0.077	0.174	REXO3_SCHPO RNA exonuclease 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rex3 PE=3 SV=1
11	O94443	2.09e-33	140	631	0.061	0.119	YFE9_SCHPO Uncharacterized exonuclease C637.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.09 PE=3 SV=2
12	P53331	1.06e-31	134	553	0.062	0.137	REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RNH70 PE=1 SV=1
13	Q580Z1	1.85e-28	125	789	0.059	0.091	Q580Z1_TRYB2 Exonuclease domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10J17.670 PE=4 SV=1
14	Q9VRX7	4.85e-27	120	681	0.051	0.091	Q9VRX7_DROME LD29573p OS=Drosophila melanogaster OX=7227 GN=Rexo5 PE=1 SV=1
15	Q12090	8.63e-27	116	404	0.074	0.223	REXO3_YEAST RNA exonuclease 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REX3 PE=1 SV=1
16	Q54EC1	2.96e-25	115	694	0.057	0.099	Q54EC1_DICDI RNA exonuclease 1 OS=Dictyostelium discoideum OX=44689 GN=rexo1 PE=4 SV=1
17	Q96IC2	5.82e-24	111	774	0.057	0.089	REXO5_HUMAN RNA exonuclease 5 OS=Homo sapiens OX=9606 GN=REXO5 PE=2 SV=1
18	Q8RXK2	2.91e-23	109	782	0.052	0.081	SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana OX=3702 GN=SDN3 PE=1 SV=1
19	A3KPE8	1.33e-20	98.2	409	0.051	0.152	SDN1_ARATH Small RNA degrading nuclease 1 OS=Arabidopsis thaliana OX=3702 GN=SDN1 PE=1 SV=1
20	Q8WTP8	6.19e-16	82.8	325	0.047	0.175	AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens OX=9606 GN=AEN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15870 EloA-BP1	1.4e-65	231.9	ElonginA binding-protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000170168

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265881	0.916	Oligoribonuclease, mitochondrial
2	9606.ENSP00000261377	0.856	Putative RNA exonuclease NEF-sp
3	9606.ENSP00000395574	0.802	Elongin-A
4	9606.ENSP00000428426	0.787	Transcription elongation factor A protein 1
5	9606.ENSP00000311977	0.735	tRNA-dihydrouridine(47) synthase [NAD(P)(+)]-like
6	9606.ENSP00000316007	0.697	Secretory carrier-associated membrane protein 4
7	9606.ENSP00000250974	0.696	Protein ABHD17A
8	9606.ENSP00000380495	0.694	ATP-dependent RNA helicase DDX51
9	9606.ENSP00000341905	0.683	RAS protein activator like-3
10	9606.ENSP00000355506	0.681	Exonuclease 1
11	9606.ENSP00000363944	0.649	Ribosomal biogenesis protein LAS1L
12	9606.ENSP00000366135	0.636	Exosome component 10
13	9606.ENSP00000455106	0.619	Ribosome biogenesis protein BOP1
14	9606.ENSP00000378254	0.616	Echinoderm microtubule-associated protein-like 3
15	9606.ENSP00000480158	0.614	DNA-directed RNA polymerase II subunit RPB1
16	9606.ENSP00000234827	0.611	Transcription elongation factor A N-terminal and central domain containing 2
17	9606.ENSP00000225298	0.597	U3 small nucleolar RNA-associated protein 18 homolog
18	9606.ENSP00000285814	0.586	Nucleolar protein interacting with the FHA domain of MKI67
19	9606.ENSP00000244230	0.581	U3 small nucleolar ribonucleoprotein protein MPP10
20	9606.ENSP00000255608	0.566	BTB/POZ domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0003824	0.987	catalytic activity
GO:1901363	0.958	heterocyclic compound binding
GO:0097159	0.958	organic cyclic compound binding
GO:0003676	0.946	nucleic acid binding
GO:0008408	0.850	3'-5' exonuclease activity
GO:0000175	0.512	3'-5'-RNA exonuclease activity
GO:0003723	0.369	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0050789	0.990	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0044237	0.976	cellular metabolic process
GO:0044238	0.975	primary metabolic process
GO:0043170	0.941	macromolecule metabolic process
GO:0019222	0.895	regulation of metabolic process
GO:0006807	0.884	nitrogen compound metabolic process
GO:0051171	0.883	regulation of nitrogen compound metabolic process
GO:0080090	0.864	regulation of primary metabolic process
GO:0031323	0.850	regulation of cellular metabolic process
GO:0060255	0.840	regulation of macromolecule metabolic process
GO:0019219	0.806	regulation of nucleobase-containing compound metabolic process
GO:0090304	0.726	nucleic acid metabolic process
GO:0044249	0.304	cellular biosynthetic process
GO:1901576	0.303	organic substance biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	0.996	nuclear body
GO:0005737	0.698	cytoplasm
GO:0032991	0.365	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.850	Acting on ester bonds.
EC:3.1.13.-	0.512	Exoribonucleases producing 5'-phosphomonoesters.

[back to server]