StarFunc result for job id Q8N1I0

User Input

>input (1966 residues)
MWIPTEHEKYGVVIASFRGTVPYGLSLEIGDTVQILEKCDGWYRGFALKNPNIKGIFPSS
YVHLKNACVKNKGQFEMVIPTEDSVITEMTSTLRDWGTMWKQLYVRNEGDLFHRLWHIMN
EILDLRRQVLVGHLTHDRMKDVKRHITARLDWGNEQLGLDLVPRKEYAMVDPEDISITEL
YRLMEHRHRKKDTPVQASSHHLFVQMKSLMCSNLGEELEVIFSLFDSKENRPISERFFLR
LNRNGLPKAPDKPERHCSLFVDLGSSELRKDIYITVHIIRIGRMGAGEKKNACSVQYRRP
FGCAVLSIADLLTGETKDDLILKVYMCNTESEWYQIHENIIKKLNARYNLTGSNAGLAVS
LQLLHGDIEQIRREYSSVFSHGVSITRKLGFSNIIMPGEMRNDLYITIERGEFEKGGKSV
ARNVEVTMFIVDSSGQTLKDFISFGSGEPPASEYHSFVLYHNNSPRWSELLKLPIPVDKF
RGAHIRFEFRHCSTKEKGEKKLFGFSFVPLMQEDGRTLPDGTHELIVHKCEENTNLQDTT
RYLKLPFSKGIFLGNNNQAMKATKESFCITSFLCSTKLTQNGDMLDLLKWRTHPDKITGC
LSKLKEIDGSEIVKFLQDTLDTLFGILDENSQKYGSKVFDSLVHIINLLQDSKFHHFKPV
MDTYIESHFAGALAYRDLIKVLKWYVDRITEAERQEHIQEVLKAQEYIFKYIVQSRRLFS
LATGGQNEEEFRCCIQELLMSVRFFLSQESKGSGALSQSQAVFLSSFPAVYSELLKLFDV
REVANLVQDTLGSLPTILHVDDSLQAIKLQCIGKTVESQLYTNPDSRYILLPVVLHHLHI
HLQEQKDLIMCARILSNVFCLIKKNSSEKSVLEEIDVIVASLLDILLRTILEITSRPQPS
SSAMRFQFQDVTGEFVACLLSLLRQMTDRHYQQLLDSFNTKEELRDFLLQIFTVFRILIR
PEMFPKDWTVMRLVANNVIITTVLYLSDALRKNFLNENFDYKIWDSYFYLAVIFINQLCL
QLEMFTPSKKKKVLEKYGDMRVTMGCEIFSMWQNLGEHKLHFIPALIGPFLEVTLIPQPD
LRNVMIPIFHDMMDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIE
RETWRESGVSLIATVTRLMERLLDYRDCMKMGEVDGKKIGCTVSLLNFYKTELNKEEMYI
RYIHKLYDLHLKAQNFTEAAYTLLLYDELLEWSDRPLREFLTYPMQTEWQRKEHLHLTII
QNFDRGKCWENGIILCRKIAEQYESYYDYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVG
FYGKKFPFFLRNKEFVCRGHDYERLEAFQQRMLNEFPHAIAMQHANQPDETIFQAEAQYL
QIYAVTPIPESQEVLQREGVPDNIKSFYKVNHIWKFRYDRPFHKGTKDKENEFKSLWVER
TSLYLVQSLPGISRWFEVEKREVVEMSPLENAIEVLENKNQQLKTLISQCQTRQMQNINP
LTMCLNGVIDAAVNGGVSRYQEAFFVKEYILSHPEDGEKIARLRELMLEQAQILEFGLAV
HEKFVPQDMRPLHKKLVDQFFVMKSSLGIQEFSACMQASPVHFPNGSPRVCRNSAPASVS
PDGTRVIPRRSPLSYPAVNRYSSSSLSSQASAEVSNITGQSESSDEVFNMQPSPSTSSLS
STHSASPNVTSSAPSSARASPLLSDKHKHSRENSCLSPRERPCSAIYPTPVEPSQRMLFN
HIGDGALPRSDPNLSAPEKAVNPTPSSWSLDSGKEAKNMSDSGKLISPPVPPRPTQTASP
ARHTTSVSPSPAGRSPLKGSVQSFTPSPVEYHSPGLISNSPVLSGSYSSGISSLSRCSTS
ETSGFENQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSL
SIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P59764	0.865	0.860	0.000	1978	0.983	0.977	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
2	AFDB:Q8IZD9	0.781	0.757	0.000	2030	0.575	0.557	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
3	PDB:6tgbA	0.586	0.773	3.637E-60	1450	0.234	0.317	6tgbA.pdb.gz
4	AFDB:P29539	0.086	0.088	1.499E-11	1916	0.096	0.098	P29539.pdb.gz	RIF1_YEAST Telomere length regulator protein RIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RIF1 PE=1 SV=3
5	AFDB:F4J8G7	0.112	0.107	3.921E-9	2138	0.108	0.099	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
6	AFDB:E1C2U2	0.171	0.152	4.608E-9	2326	0.093	0.078	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
7	AFDB:Q5UIP0	0.127	0.106	4.995E-9	2472	0.091	0.072	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
8	AFDB:F4IAT2	0.110	0.116	2.222E-8	1823	0.099	0.106	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
9	AFDB:Q2QCI8	0.094	0.089	1.885E-7	2173	0.086	0.078	Q2QCI8.pdb.gz	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
10	AFDB:Q14152	0.102	0.131	1.361E-6	1382	0.083	0.118	Q14152.pdb.gz	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
11	PDB:4yknA	0.069	0.107	1.670E-6	1205	0.062	0.101	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
12	PDB:7lq1A	0.068	0.135	3.059E-6	950	0.051	0.106	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
13	PDB:6pyuA	0.065	0.130	4.963E-6	930	0.053	0.112	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
14	PDB:7mq8LM	0.140	0.138	6.073E-6	2005	0.051	0.050	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:2xwuB	0.118	0.208	1.206E-5	910	0.051	0.110	2xwuB.pdb.gz
16	PDB:7wttK	0.075	0.113	1.665E-5	1022	0.063	0.120	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	PDB:5itdA	0.072	0.133	1.805E-5	995	0.049	0.096	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
18	PDB:7qpgR	0.081	0.076	2.813E-5	2208	0.095	0.084	7qpgR.pdb.gz
19	PDB:3gjxA	0.113	0.171	3.305E-5	1041	0.044	0.083	3gjxA.pdb.gz	Crystal Structure of the Nuclear Export Receptor CRM1 in Complex with Snurportin1 and RanGTP.
20	AFDB:O95996	0.093	0.085	4.737E-5	2303	0.113	0.097	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A096LNH6	1189	1886	0.338	0.352	A0A096LNH6_HUMAN Dedicator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=1
2	A0A0B4K7Q6	890	2008	0.306	0.299	A0A0B4K7Q6_DROME Myoblast city, isoform B OS=Drosophila melanogaster OX=7227 GN=mbc PE=3 SV=1
3	A0A0B4KHD2	1251	2008	0.347	0.340	A0A0B4KHD2_DROME Sponge, isoform F OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=1
4	A0A590UJ51	1847	898	0.456	0.999	A0A590UJ51_HUMAN Dedicator of cytokinesis 4 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
5	A8E1V6	1157	1866	0.335	0.353	A8E1V6_DANRE Dedicator of cytokinesis 1 OS=Danio rerio OX=7955 GN=dock1 PE=1 SV=1
6	A8E1V7	1103	1867	0.318	0.335	A8E1V7_DANRE Dedicator of cytokinesis 5 OS=Danio rerio OX=7955 GN=dock5 PE=1 SV=1
7	B2RY04	1151	1868	0.325	0.342	DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus OX=10090 GN=Dock5 PE=1 SV=2
8	B7Z0R2	1258	2002	0.348	0.342	B7Z0R2_DROME Sponge, isoform D OS=Drosophila melanogaster OX=7227 GN=spg PE=1 SV=2
9	C9J637	1725	849	0.423	0.980	C9J637_HUMAN Dedicator of cytokinesis 4 OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=2
10	H0Y599	4031	1999	0.993	0.977	H0Y599_HUMAN Dedicator of cytokinesis 4 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
11	H0Y7N4	647	1090	0.199	0.360	H0Y7N4_HUMAN Dedicator of cytokinesis 5 (Fragment) OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=1
12	P59764	4011	1978	0.983	0.977	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
13	Q14185	1195	1865	0.337	0.355	DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2
14	Q149N5	4056	2011	0.998	0.976	Q149N5_HUMAN DOCK4 protein OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=1
15	Q8BUR4	1178	1865	0.353	0.372	DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus OX=10090 GN=Dock1 PE=1 SV=3
16	Q8C3J5	1156	1828	0.323	0.347	DOCK2_MOUSE Dedicator of cytokinesis protein 2 OS=Mus musculus OX=10090 GN=Dock2 PE=1 SV=3
17	Q8CIQ7	2164	2027	0.570	0.553	DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus OX=10090 GN=Dock3 PE=1 SV=1
18	Q8IZD9	2173	2030	0.575	0.557	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
19	Q8MQY7	814	1543	0.255	0.325	Q8MQY7_DROME RE54856p OS=Drosophila melanogaster OX=7227 GN=mbc PE=2 SV=1
20	Q8N1I0	4088	1966	1.000	1.000	DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens OX=9606 GN=DOCK4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06920 DHR-2_Lobe_A	5.6e-07	41.4	DHR-2, Lobe A
2	PF20422 DHR-2_Lobe_B	7.6e-11	53.3	DHR-2, Lobe B
3	PF20421 DHR-2_Lobe_C	2.2e-14	64.5	DHR-2, Lobe C
4	PF14429 DOCK-C2	4.3e-53	191.5	C2 domain in Dock180 and Zizimin proteins
5	PF16172 DOCK_N	2.2e-91	318.3	DOCK N-terminus
6	PF00018 SH3_1	3.7	18.6	SH3 domain
7	PF07653 SH3_2	0.059	24.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000404179

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000435370	0.989	Ubiquitin-like protein FUBI
2	9606.ENSP00000272317	0.973	Ubiquitin-40S ribosomal protein S27a
3	9606.ENSP00000377640	0.970	Ribosomal protein L24
4	9606.ENSP00000376345	0.968	Growth factor receptor-bound protein 2
5	9606.ENSP00000403172	0.965	60S ribosomal protein L6
6	9606.ENSP00000388107	0.964	Ubiquitin-60S ribosomal protein L40
7	9606.ENSP00000435096	0.963	Ribosomal protein S25
8	9606.ENSP00000379339	0.961	Ribosomal protein S29
9	9606.ENSP00000447001	0.961	60S ribosomal protein L18
10	9606.ENSP00000467466	0.961	Ribosomal protein S15
11	9606.ENSP00000274242	0.960	60S ribosomal protein L37
12	9606.ENSP00000322419	0.959	60S acidic ribosomal protein P2
13	9606.ENSP00000379888	0.959	Ribosomal protein S8
14	9606.ENSP00000418868	0.959	60S ribosomal protein L29
15	9606.ENSP00000307940	0.958	Elongation factor 2
16	9606.ENSP00000428085	0.958	Ribosomal protein L30
17	9606.ENSP00000472469	0.958	Ribosomal protein S28
18	9606.ENSP00000309830	0.957	Ribosomal protein L38
19	9606.ENSP00000345957	0.957	Ribosomal protein S21
20	9606.ENSP00000418082	0.957	Ribosomal protein L37a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005085	0.999	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.987	biological regulation
GO:0050794	0.982	regulation of cellular process
GO:0050896	0.927	response to stimulus
GO:0032501	0.926	multicellular organismal process
GO:0048518	0.874	positive regulation of biological process
GO:0048522	0.799	positive regulation of cellular process
GO:0035150	0.755	regulation of tube size
GO:0003013	0.726	circulatory system process
GO:0003018	0.687	vascular process in circulatory system
GO:0008015	0.669	blood circulation
GO:0035296	0.668	regulation of tube diameter
GO:0040012	0.602	regulation of locomotion
GO:0051239	0.600	regulation of multicellular organismal process
GO:0051716	0.571	cellular response to stimulus
GO:0065009	0.565	regulation of molecular function
GO:0050790	0.550	regulation of catalytic activity
GO:0044057	0.500	regulation of system process
GO:0097746	0.483	blood vessel diameter maintenance
GO:0048870	0.470	cell motility
GO:0071840	0.450	cellular component organization or biogenesis
GO:0060255	0.432	regulation of macromolecule metabolic process
GO:0031323	0.432	regulation of cellular metabolic process
GO:0080090	0.428	regulation of primary metabolic process
GO:0051171	0.417	regulation of nitrogen compound metabolic process
GO:0048519	0.414	negative regulation of biological process
GO:2000145	0.407	regulation of cell motility
GO:0030334	0.399	regulation of cell migration
GO:0071704	0.390	organic substance metabolic process
GO:0030335	0.312	positive regulation of cell migration
GO:0044237	0.302	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0031981	0.998	nuclear lumen
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0016020	0.992	membrane
GO:0012505	0.989	endomembrane system
GO:0005886	0.968	plasma membrane
GO:0005730	0.962	nucleolus
GO:0032991	0.756	protein-containing complex
GO:0005654	0.490	nucleoplasm
GO:0120025	0.352	plasma membrane bounded cell projection
GO:0005794	0.334	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]