StarFunc result for job id Q8N1L9

User Input

>input (274 residues)
MHLCGGNGLLTQTDPKEQQRQLKKQKNRAAAQRSRQKHTDKADALHQQHESLEKDNLALR
KEIQSLQAELAWWSRTLHVHERLCPMDCASCSAPGLLGCWDQAEGLLGPGPQGQHGCREQ
LELFQTPGSCYPAQPLSPGPQPHDSPSLLQCPLPSLSLGPAVVAEPPVQLSPSPLLFASH
TGSSLQGSSSKLSALQPSLTAQTAPPQPLELEHPTRGKLGSSPDNPSSALGLARLQSREH
KPALSAATWQGLVVDPSPHPLLAFPLLSSAQVHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N1L9	0.999	0.999	1.753E-40	274	1.000	1.000	Q8N1L9.pdb.gz	BATF2_HUMAN Basic leucine zipper transcriptional factor ATF-like 2 OS=Homo sapiens OX=9606 GN=BATF2 PE=1 SV=1
2	AFDB:P01100	0.277	0.204	6.155E-4	380	0.204	0.147	P01100.pdb.gz	FOS_HUMAN Protein c-Fos OS=Homo sapiens OX=9606 GN=FOS PE=1 SV=1
3	AFDB:Q5A4X5	0.209	0.113	4.517E-2	559	0.193	0.095	Q5A4X5.pdb.gz	SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SKN7 PE=3 SV=1
4	AFDB:Q76M54	0.202	0.126	9.009E-2	501	0.172	0.094	Q76M54.pdb.gz	Q76M54_ONCMY Heat shock transcription factor 1 isoform a OS=Oncorhynchus mykiss OX=8022 GN=HSF1 PE=2 SV=1
5	AFDB:Q14152	0.199	0.049	1.940E-1	1382	0.175	0.035	Q14152.pdb.gz	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
6	AFDB:Q76NV1	0.229	0.084	2.095E-1	836	0.062	0.020	Q76NV1.pdb.gz	DYRK1_DICDI Probable serine/threonine-protein kinase dyrk1 OS=Dictyostelium discoideum OX=44689 GN=dyrk1 PE=3 SV=1
7	AFDB:B7ZNG0	0.191	0.048	2.262E-1	1348	0.182	0.037	B7ZNG0.pdb.gz	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
8	AFDB:F4HRT5	0.201	0.062	2.637E-1	1132	0.175	0.042	F4HRT5.pdb.gz	CRWN1_ARATH Protein CROWDED NUCLEI 1 OS=Arabidopsis thaliana OX=3702 GN=CRWN1 PE=1 SV=1
9	AFDB:P16649	0.184	0.089	3.074E-1	713	0.164	0.063	P16649.pdb.gz	TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TUP1 PE=1 SV=2
10	AFDB:Q7SXL7	0.228	0.152	3.869E-1	423	0.150	0.097	Q7SXL7.pdb.gz	FL2D_DANRE Pre-mRNA-splicing regulator WTAP OS=Danio rerio OX=7955 GN=wtap PE=2 SV=1
11	PDB:3ib7A	0.058	0.054	9.390	295	0.022	0.020	3ib7A.pdb.gz	A mycobacterial cyclic AMP phosphodiesterase that moonlights as a modifier of cell wall permeability

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N1L9	0.0	538	274	1.000	1.000	BATF2_HUMAN Basic leucine zipper transcriptional factor ATF-like 2 OS=Homo sapiens OX=9606 GN=BATF2 PE=1 SV=1
2	Q8R1H8	1.09e-71	223	277	0.631	0.625	BATF2_MOUSE Basic leucine zipper transcriptional factor ATF-like 2 OS=Mus musculus OX=10090 GN=Batf2 PE=2 SV=1
3	Q9D275	6.01e-18	79.7	118	0.139	0.322	BATF3_MOUSE Basic leucine zipper transcriptional factor ATF-like 3 OS=Mus musculus OX=10090 GN=Batf3 PE=2 SV=1
4	P97876	2.25e-16	75.9	133	0.131	0.271	BATF3_RAT Basic leucine zipper transcriptional factor ATF-like 3 OS=Rattus norvegicus OX=10116 GN=Batf3 PE=1 SV=1
5	Q16520	5.46e-16	74.7	125	0.139	0.304	BATF_HUMAN Basic leucine zipper transcriptional factor ATF-like OS=Homo sapiens OX=9606 GN=BATF PE=1 SV=1
6	Q9NR55	8.23e-16	74.3	127	0.128	0.276	BATF3_HUMAN Basic leucine zipper transcriptional factor ATF-like 3 OS=Homo sapiens OX=9606 GN=BATF3 PE=1 SV=1
7	O35284	1.48e-14	70.9	125	0.124	0.272	BATF_MOUSE Basic leucine zipper transcriptional factor ATF-like OS=Mus musculus OX=10090 GN=Batf PE=1 SV=1
8	P21525	7.51e-06	49.3	755	0.080	0.029	FOSLA_DROME Transcription factor kayak, isoforms A/B/F OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=4
9	A8MPH9	1.14e-05	48.9	722	0.080	0.030	FOSLD_DROME Transcription factor kayak, isoforms D/sro OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=2
10	Q84LG2	1.34e-05	48.1	389	0.088	0.062	BZP68_ARATH bZIP transcription factor 68 OS=Arabidopsis thaliana OX=3702 GN=BZIP68 PE=1 SV=1
11	Q501B2	2.42e-05	47.4	409	0.084	0.056	BZP16_ARATH bZIP transcription factor 16 OS=Arabidopsis thaliana OX=3702 GN=BZIP16 PE=1 SV=1
12	Q8R0S1	3.24e-05	47.0	413	0.109	0.073	ATF7_MOUSE Cyclic AMP-dependent transcription factor ATF-7 OS=Mus musculus OX=10090 GN=Atf7 PE=1 SV=1
13	P42774	3.33e-05	47.0	315	0.088	0.076	GBF1_ARATH G-box-binding factor 1 OS=Arabidopsis thaliana OX=3702 GN=GBF1 PE=1 SV=2
14	P17544	5.49e-05	46.6	483	0.124	0.070	ATF7_HUMAN Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7 PE=1 SV=3
15	Q8K1L0	7.76e-05	45.8	357	0.106	0.081	CREB5_MOUSE Cyclic AMP-responsive element-binding protein 5 OS=Mus musculus OX=10090 GN=Creb5 PE=2 SV=3
16	Q02930	9.95e-05	45.8	508	0.106	0.057	CREB5_HUMAN Cyclic AMP-responsive element-binding protein 5 OS=Homo sapiens OX=9606 GN=CREB5 PE=1 SV=3
17	Q80IW5	1.27e-04	45.1	398	0.099	0.068	Q80IW5_9ALPH Long Meq OS=Gallid alphaherpesvirus 2 OX=10390 GN=L-meq PE=4 SV=1
18	Q41735	2.13e-04	44.7	377	0.084	0.061	Q41735_MAIZE G-box binding factor 1 OS=Zea mays OX=4577 GN=GBF1 PE=2 SV=1
19	A2R6G8	2.25e-04	43.9	221	0.099	0.122	OTAR1_ASPNC Transcription factor otaR1 OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=otaR1 PE=2 SV=1
20	Q40645	3.93e-04	43.5	360	0.077	0.058	Q40645_ORYSA OSBZ8 OS=Oryza sativa OX=4530 GN=Oryza sativa bZIP protein 8 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	1.1e-06	40.0	bZIP transcription factor
2	PF07716 bZIP_2	0.0061	27.9	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.3	23.0	bZIP Maf transcription factor
4	PF11690 DUF3287	7.5e+02	11.2	Protein of unknown function (DUF3287)
5	PF02183 HALZ	0.87	21.1	Homeobox associated leucine zipper
6	PF04849 HAP1_N	6.9	17.4	HAP1 N-terminal conserved region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000301887

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286639	0.830	Basic leucine zipper transcriptional factor ATF-like
2	9606.ENSP00000360266	0.830	Transcription factor AP-1
3	9606.ENSP00000243440	0.827	Basic leucine zipper transcriptional factor ATF-like 3
4	9606.ENSP00000245414	0.661	Interferon regulatory factor 1
5	9606.ENSP00000314543	0.655	Melanoma-associated antigen B18
6	9606.ENSP00000403683	0.654	SOSS complex subunit B2
7	9606.ENSP00000284486	0.644	Protein FAM167A
8	9606.ENSP00000366006	0.634	UbiA prenyltransferase domain-containing protein 1
9	9606.ENSP00000268638	0.609	Interferon regulatory factor 8
10	9606.ENSP00000303315	0.606	Transcription factor jun-B
11	9606.ENSP00000360998	0.527	Ankyrin repeat domain-containing protein 22
12	9606.ENSP00000380605	0.523	Ly6/PLAUR domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.978	heterocyclic compound binding
GO:0097159	0.978	organic cyclic compound binding
GO:0003677	0.971	DNA binding
GO:0043565	0.957	sequence-specific DNA binding
GO:0003690	0.905	double-stranded DNA binding
GO:1990837	0.903	sequence-specific double-stranded DNA binding
GO:0000976	0.812	transcription cis-regulatory region binding
GO:0140110	0.576	transcription regulator activity
GO:0003700	0.568	DNA-binding transcription factor activity
GO:0000981	0.537	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050896	0.982	response to stimulus
GO:0009605	0.902	response to external stimulus
GO:0050789	0.899	regulation of biological process
GO:0032501	0.864	multicellular organismal process
GO:0006950	0.841	response to stress
GO:0051707	0.825	response to other organism
GO:0002521	0.820	leukocyte differentiation
GO:0050794	0.797	regulation of cellular process
GO:0030099	0.748	myeloid cell differentiation
GO:0002573	0.721	myeloid leukocyte differentiation
GO:0045321	0.710	leukocyte activation
GO:1903131	0.680	mononuclear cell differentiation
GO:0019222	0.665	regulation of metabolic process
GO:0080090	0.612	regulation of primary metabolic process
GO:0010468	0.607	regulation of gene expression
GO:0051171	0.585	regulation of nitrogen compound metabolic process
GO:0097028	0.558	dendritic cell differentiation
GO:0006355	0.558	regulation of DNA-templated transcription
GO:0048518	0.553	positive regulation of biological process
GO:0048522	0.512	positive regulation of cellular process
GO:0006952	0.476	defense response
GO:0098542	0.405	defense response to other organism
GO:0048519	0.392	negative regulation of biological process
GO:0031325	0.338	positive regulation of cellular metabolic process
GO:0010604	0.333	positive regulation of macromolecule metabolic process
GO:0045935	0.329	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.319	positive regulation of DNA-templated transcription
GO:0048523	0.307	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005667	0.996	transcription regulator complex
GO:0090575	0.993	RNA polymerase II transcription regulator complex
GO:0005737	0.927	cytoplasm
GO:0043233	0.745	organelle lumen
GO:0070013	0.718	intracellular organelle lumen
GO:0031981	0.481	nuclear lumen
GO:0005654	0.414	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]