StarFunc result for job id Q8N1N2

User Input

>input (210 residues)
MVADIKGNEQIEKYSWREACDTGSSRMDRKHGKYILNVEHSENQPPITHPNDQEAHSSIC
WCLPSNDITSDVSPNLTGVCVNPGILAHSRCLQSESCNTQVKEYCRNDWSMWKVFLACLL
ACVIMTAIGVLIICLVNNKGSANSSIVIQLSTNDGECVTVKPGTPSPACPPTMTTTSTVP
ASTATESTTSTATAATTSTEPITVAPTDHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N1N2	0.999	0.999	6.570E-28	210	1.000	1.000	Q8N1N2.pdb.gz	DYNAP_HUMAN Dynactin-associated protein OS=Homo sapiens OX=9606 GN=DYNAP PE=1 SV=1
2	AFDB:O22763	0.124	0.077	1.504	411	0.162	0.083	O22763.pdb.gz	BZP10_ARATH Basic leucine zipper 10 OS=Arabidopsis thaliana OX=3702 GN=BZIP10 PE=1 SV=2
3	AFDB:Q8WV28	0.099	0.055	2.123	456	0.148	0.068	Q8WV28.pdb.gz	BLNK_HUMAN B-cell linker protein OS=Homo sapiens OX=9606 GN=BLNK PE=1 SV=2
4	AFDB:Q6FIM7	0.129	0.058	2.610	541	0.129	0.050	Q6FIM7.pdb.gz	Q6FIM7_CANGA Candida glabrata strain CBS138 chromosome M complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=MSN4 PE=4 SV=1
5	AFDB:Q9FGF3	0.166	0.083	3.684	513	0.119	0.049	Q9FGF3.pdb.gz	Q9FGF3_ARATH At5g64430 OS=Arabidopsis thaliana OX=3702 GN=At5g64430 PE=1 SV=1
6	AFDB:Q8BYU9	0.141	0.079	5.200	414	0.157	0.080	Q8BYU9.pdb.gz	Q8BYU9_MOUSE SECIS binding protein 2 OS=Mus musculus OX=10090 GN=Secisbp2 PE=1 SV=1
7	AFDB:Q38DL8	0.143	0.047	5.571	746	0.133	0.038	Q38DL8.pdb.gz	Q38DL8_TRYB2 DNA repair protein RAD2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2870 PE=3 SV=1
8	AFDB:Q58EM1	0.122	0.053	5.969	582	0.114	0.041	Q58EM1.pdb.gz
9	AFDB:O80683	0.082	0.074	8.425	238	0.129	0.113	O80683.pdb.gz	CAB25_ARATH Calmodulin-binding protein 25 OS=Arabidopsis thaliana OX=3702 GN=CAMBP25 PE=1 SV=1
10	AFDB:Q8L6Z7	0.124	0.054	9.026	735	0.124	0.035	Q8L6Z7.pdb.gz	EXO1_ARATH Exonuclease 1 OS=Arabidopsis thaliana OX=3702 GN=EXO1 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N1N2	2.01e-155	430	210	1.000	1.000	DYNAP_HUMAN Dynactin-associated protein OS=Homo sapiens OX=9606 GN=DYNAP PE=1 SV=1
2	O02252	0.64	33.5	1080	0.095	0.019	O02252_CAEEL Peptidase S28 OS=Caenorhabditis elegans OX=6239 GN=pcp-3 PE=1 SV=2
3	O14798	3.1	30.8	259	0.105	0.085	TR10C_HUMAN Tumor necrosis factor receptor superfamily member 10C OS=Homo sapiens OX=9606 GN=TNFRSF10C PE=1 SV=3
4	Q23238	4.2	30.8	893	0.081	0.019	ULP2_CAEEL Ubiquitin-like protease 2 OS=Caenorhabditis elegans OX=6239 GN=ulp-2 PE=1 SV=2
5	Q4KMQ1	4.3	30.8	711	0.086	0.025	TPRN_HUMAN Taperin OS=Homo sapiens OX=9606 GN=TPRN PE=1 SV=2
6	Q8LFP1	5.4	30.0	241	0.086	0.075	PRA1H_ARATH PRA1 family protein H OS=Arabidopsis thaliana OX=3702 GN=PRA1H PE=2 SV=1
7	P47825	5.8	30.4	921	0.105	0.024	TAF4_DROME Transcription initiation factor TFIID subunit 4 OS=Drosophila melanogaster OX=7227 GN=Taf4 PE=1 SV=1
8	E7F2X0	7.9	30.0	1569	0.086	0.011	E7F2X0_DANRE CAP-GLY domain-containing linker protein 1a OS=Danio rerio OX=7955 GN=clip1a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15675 CLLAC	2.5e-14	63.8	CLLAC-motif containing domain
2	PF01456 Mucin	64	15.0	Mucin-like glycoprotein
3	PF01169 UPF0016	1.9e+02	13.8	Uncharacterized protein family UPF0016

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9365.XP_007519302.1

Rank	PPI partner	STRING score	Description
1	9365.XP_007526416.1	0.581	Tetratricopeptide repeat protein 9C
2	9365.XP_007519300.1	0.539	stAR-related lipid transfer protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0051716	0.987	cellular response to stimulus
GO:0080090	0.977	regulation of primary metabolic process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0060255	0.976	regulation of macromolecule metabolic process
GO:0043085	0.975	positive regulation of catalytic activity
GO:0048518	0.966	positive regulation of biological process
GO:0010604	0.959	positive regulation of macromolecule metabolic process
GO:0051173	0.957	positive regulation of nitrogen compound metabolic process
GO:0051347	0.954	positive regulation of transferase activity
GO:0048522	0.948	positive regulation of cellular process
GO:0031323	0.936	regulation of cellular metabolic process
GO:0051247	0.936	positive regulation of protein metabolic process
GO:0031325	0.881	positive regulation of cellular metabolic process
GO:0036314	0.866	response to sterol
GO:0032147	0.861	activation of protein kinase activity
GO:0097305	0.845	response to alcohol
GO:0071396	0.838	cellular response to lipid
GO:1901701	0.802	cellular response to oxygen-containing compound
GO:0010941	0.730	regulation of cell death
GO:0097306	0.724	cellular response to alcohol
GO:0036315	0.722	cellular response to sterol
GO:0042127	0.469	regulation of cell population proliferation
GO:0042981	0.352	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005794	0.997	Golgi apparatus
GO:0005634	0.656	nucleus
GO:0043233	0.651	organelle lumen
GO:0070013	0.633	intracellular organelle lumen
GO:0005829	0.394	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]