StarFunc result for job id Q8N1N4

User Input

>input (520 residues)
MSLSPCRAQRGFSARSACSARSRGRSRGGFSSRGGFSSRSLNSFGGCLEGSRGSTWGSGG
RLGVRFGEWSGGPGLSLCPPGGIQEVTINQNLLTPLKIEIDPQFQVVRTQETQEIRTLNN
QFASFIDKVRFLEQQNKVLETKWHLLQQQGLSGSQQGLEPVFEACLDQLRKQLEQLQGER
GALDAELKACRDQEEEYKSKYEEEAHRRATLENDFVVLKKDVDGVFLSKMELEGKLEALR
EYLYFLKHLNEEELGQLQTQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEA
EALYQTKYQELQVSAQLHGDRMQETKVQISQLHQEIQRLQSQTENLKKQNASLQAAITDA
EQRGELALKDAQAKVDELEAALRMAKQNLARLLCEYQELTSTKLSLDVEIATYRRLLEGE
ECRMSGECTSQVTISSVGGSAVMSGGVGGGLGSTCGLGSGKGSPGSCCTSIVTGGSNIIL
GSGKDPVLDSCSVSGSSAGSSCHTILKKTVESSLKTSITY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N1N4	1.000	1.000	7.866E-64	520	1.000	1.000	Q8N1N4.pdb.gz	K2C78_HUMAN Keratin, type II cytoskeletal 78 OS=Homo sapiens OX=9606 GN=KRT78 PE=1 SV=2
2	AFDB:P19013	0.308	0.308	1.414E-28	520	0.523	0.523	P19013.pdb.gz	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
3	AFDB:P07744	0.416	0.413	1.905E-28	525	0.537	0.531	P07744.pdb.gz	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
4	AFDB:Q8BGZ7	0.416	0.398	2.766E-28	551	0.527	0.497	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
5	AFDB:P13647	0.523	0.469	4.661E-28	590	0.531	0.468	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
6	AFDB:Q922U2	0.383	0.350	1.655E-27	580	0.521	0.467	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
7	AFDB:Q9Z331	0.543	0.509	1.655E-27	562	0.535	0.495	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
8	AFDB:Q6PVZ5	0.324	0.287	2.588E-27	599	0.538	0.467	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
9	AFDB:P02538	0.570	0.532	3.005E-27	564	0.533	0.491	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
10	AFDB:Q14CN4	0.310	0.314	3.005E-27	511	0.487	0.495	Q14CN4.pdb.gz	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
11	PDB:4h63H	0.062	0.142	6.968	174	0.033	0.098	4h63H.pdb.gz
12	PDB:8at3A	0.104	0.182	7.507	286	0.081	0.147	8at3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L0X5	0.0	593	492	0.615	0.650	A1L0X5_MOUSE Krt78 protein (Fragment) OS=Mus musculus OX=10090 GN=Krt78 PE=2 SV=1
2	E9Q0F0	0.0	590	1068	0.602	0.293	E9Q0F0_MOUSE Keratin 78 OS=Mus musculus OX=10090 GN=Krt78 PE=1 SV=1
3	Q0VDM9	0.0	594	492	0.615	0.650	Q0VDM9_MOUSE Krt78 protein (Fragment) OS=Mus musculus OX=10090 GN=Krt78 PE=2 SV=1
4	Q0VDN0	0.0	592	513	0.615	0.624	Q0VDN0_MOUSE Krt78 protein (Fragment) OS=Mus musculus OX=10090 GN=Krt78 PE=2 SV=1
5	Q4L0E6	0.0	557	420	0.544	0.674	Q4L0E6_MOUSE Type II cytokeratin Kb40 (Fragment) OS=Mus musculus OX=10090 GN=Krt78 PE=2 SV=1
6	Q6IFT3	0.0	589	800	0.602	0.391	Q6IFT3_MOUSE Keratin Kb40 OS=Mus musculus OX=10090 GN=Krt78 PE=2 SV=1
7	Q8N1N4	0.0	1053	520	1.000	1.000	K2C78_HUMAN Keratin, type II cytoskeletal 78 OS=Homo sapiens OX=9606 GN=KRT78 PE=1 SV=2
8	Q86Y46	1.29e-164	479	540	0.523	0.504	K2C73_HUMAN Keratin, type II cytoskeletal 73 OS=Homo sapiens OX=9606 GN=KRT73 PE=1 SV=1
9	P19013	1.88e-162	473	520	0.504	0.504	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
10	P07744	1.06e-161	471	525	0.437	0.432	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
11	O95678	5.40e-161	470	551	0.488	0.461	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
12	Q6P6Q2	1.40e-160	470	576	0.440	0.398	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
13	Q5XKE5	9.81e-159	464	535	0.490	0.477	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
14	P02538	1.09e-157	462	564	0.435	0.401	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
15	P50446	1.39e-157	462	553	0.429	0.403	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
16	Q9Z331	1.93e-157	461	562	0.427	0.395	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
17	Q922U2	2.00e-157	462	580	0.429	0.384	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
18	P13647	2.50e-157	462	590	0.427	0.376	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
19	P48668	5.40e-157	461	564	0.433	0.399	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
20	P04259	1.07e-156	460	564	0.431	0.397	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	6.2e+02	11.9	Afadin- and alpha -actinin-Binding
2	PF08614 ATG16	8.7e+02	11.5	Autophagy protein 16 (ATG16)
3	PF05394 AvrB_AvrC	3.2e+02	11.9	Avirulence protein
4	PF05667 CCDC22	1.8e+02	12.3	Coiled-coil domain-containing protein 22
5	PF10473 CENP-F_leu_zip	56	15.2	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
6	PF17153 CHASE9	7.5e+02	11.6	Periplasmic sensor domain, extracellular
7	PF08653 DASH_Dam1	5.8e+02	11.7	DASH complex subunit Dam1
8	PF04977 DivIC	18	16.5	Septum formation initiator
9	PF13863 DUF4200	4.8e+02	12.5	Domain of unknown function (DUF4200)
10	PF06818 Fez1	4.9e+02	12.5	Fez1
11	PF00038 Filament	1.5e-89	312.3	Intermediate filament protein
12	PF16208 Keratin_2_head	7.4e-13	60.4	Keratin type II head

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000475216	0.963	Keratinocyte proline rich protein
2	9606.ENSP00000279022	0.654	Myosin regulatory light polypeptide 9
3	9606.ENSP00000347055	0.650	Myosin light chain 4
4	9606.ENSP00000266088	0.647	Sodium/glucose cotransporter 1
5	9606.ENSP00000379210	0.629	Myosin light chain 3
6	9606.ENSP00000261024	0.616	Solute carrier family 40 member 1
7	9606.ENSP00000329292	0.616	Gastrokine-2
8	9606.ENSP00000446955	0.587	Myosin light polypeptide 6
9	9606.ENSP00000299198	0.586	Creatine kinase B-type
10	9606.ENSP00000355180	0.576	Collagen alpha-1(VI) chain
11	9606.ENSP00000386453	0.558	Cysteine rich tail 1
12	9606.ENSP00000328625	0.553	Negative regulator of reactive oxygen species
13	9606.ENSP00000300692	0.551	T-cell surface glycoprotein CD3 delta chain
14	9606.ENSP00000357751	0.546	Cornifin-A
15	9606.ENSP00000252245	0.541	Keratin, type II cytoskeletal 75
16	9606.ENSP00000257951	0.534	Keratin, type II cuticular Hb4
17	9606.ENSP00000257974	0.532	Keratin, type II cuticular Hb2
18	9606.ENSP00000357740	0.529	Small proline-rich protein 2E
19	9606.ENSP00000307240	0.527	Keratin, type II cytoskeletal 74
20	9606.ENSP00000257901	0.523	Keratin, type II cuticular Hb5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0045103	0.950	intermediate filament-based process
GO:0032502	0.709	developmental process
GO:0048856	0.696	anatomical structure development
GO:0065007	0.466	biological regulation
GO:0050789	0.451	regulation of biological process
GO:0071840	0.321	cellular component organization or biogenesis
GO:0032501	0.316	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005737	0.999	cytoplasm
GO:0005829	0.994	cytosol
GO:0043227	0.987	membrane-bounded organelle
GO:0005576	0.985	extracellular region
GO:0031982	0.984	vesicle
GO:0043230	0.966	extracellular organelle
GO:1903561	0.957	extracellular vesicle
GO:0005615	0.888	extracellular space
GO:0070062	0.862	extracellular exosome
GO:0043229	0.843	intracellular organelle
GO:0043228	0.786	non-membrane-bounded organelle
GO:0043232	0.779	intracellular non-membrane-bounded organelle
GO:0005856	0.571	cytoskeleton
GO:0099080	0.524	supramolecular complex
GO:0016020	0.518	membrane
GO:0045111	0.479	intermediate filament cytoskeleton
GO:0071944	0.471	cell periphery
GO:0099512	0.466	supramolecular fiber
GO:0099513	0.398	polymeric cytoskeletal fiber
GO:0005882	0.324	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]