StarFunc result for job id Q8N1P7

User Input

>input (1661 residues)
MEEAGGPMARAKARVVSATLTWRQRPPTQEEIKHGFHKVSLVSGAQMEAPQKEMFEFSRR
EEVEVNGFATQEEETVNCQGPRDTAGSKNFQSHGPIFSKKYIPPPKEKRPEGRLKEAVDQ
SDGSRQAPRTEPPCVGAMARTELLVPLPGPREPSPHPGVGLTSGSSRSLEEYRVTRTVRT
TTVVGGHVDRRMSSSVTVRPVSSGEALPRGRQVSRMVPPVVVGSPPGSPSRSQAVKVLSN
LVPAGHSPPASHLPRPTAGGPRSTGLGSTVGAALRQLPETGTAELKDSSALASTGIPASA
HLPKNQDAPAACPDRDQGRAPDARACELWQVLGAPSSTELPLQTSQGQASVPSSPRLETH
VPSPGLTHPAKQPVVPTHPGARLTPLVLPPKKKDGPVDPPAATVLPMVRSEHVTVPGQPP
APSTTRRKDVPSPGGLSAPSSPRNKFVQNSENVPVLPFTQREVVKGPGAPAASSPTRKEV
VQGSSASAASSPTWKEVVKGPGAPAASSPTQKEVVQGSSAPAALFPTWKEVVKGPGAPDA
SFPTWKEVVKGPGAPAASSPTQKEVVQGSGAPAALSTTPKEVVKGPGAPAASSPTQKEVV
KGPCAPAASSPTQKEVVQGSGAPAALSPKSTEVVQGPKGSSSIQKEAVQGIAGSLAPPLT
KEETVQGPIAPATSLPKQDKGVQDSEGSPISSLTQKEVVQDPDALPAPSSSVDRVSPSPG
GTPAPVPTGAEASTESQLVSDPTEGKTCTETSREEDEVALAADLEIFLDTLRSMEPPEIL
RTHRLPRAPRSSYLSMYATLPAIEEDQLGPWVLGPGPQEVPSLEEKEEEEEEEPENPYLS
DDEKLQRRQEKAGPSPSRDLHPARPTQVSCSPLEMMKKHVAGTKGPHSELGLELQGGSRP
TSRLGGSLLFGSLVPTAKEASTPEPLGTKLSALLPHGAPGLRKVPGQLPLLCSERSSPTE
KLACSLPLEGWSPALKTQGKLNTRPGKVIFFSESGCQGSGREVWGDIVDASGWAPVASIR
VVRGCWVLYEEPEFRGQKLVLPEGDMELRTPGTKWSPQGIGSLRRVVWDYSTPEISLFSE
EGLKGEQVKLTEALKNSQGLEKPLQVASATVSAGLWLLYPKPLFEDTPYILEPGEYPTSE
AWGTSDPSVGSLKPMRLGCPSVEKPGEPRAVVYEAPGFQGRSWEVSRDIYNLQQPEDSQS
PHLASVGSLRVLGGCWVGYEKEGFRGHQYLLEEGEYPDWSHWGGYDELLTSLRVIRTDFG
DPAVVLFEAMDFEGHGVEVSKALPDVELVQHGPSTQAIHVLSGVWVAYQEVGFSGEQYVL
EKGVYRNCEDWGAGNSTLASLQPVLQVGEHDLHFVSKIQLFSRPDFLGDHFSFEDDQAAL
PASFRPQSCRVHGGSWILFDETNFEGDQHILSEGEFPTLTAMGCLASTVLGSLQKVSLHF
SEPSIFLYGLECFEGKEIELSREVRSLQAEGFNNHVLSVRIKGGIWVLCEHSDFRGRQWL
VGSCEITNWLTYSGTQRVGSLYPIKQRRVYFRLWNAALGGFLAVPDHVEDMKAGRVVVAD
PQAGGSCIWYYEDGLLKNQMAPTMSLQVIGPPSPGSKVVLWAESRLPRQTWSISESGHIC
SQMFEGQILDVKGGRGYDRDHVVLWEPDEDRASQIWTIHVL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1a5dA	0.101	0.918	9.311E-16	173	0.038	0.364	1a5dA.pdb.gz
2	PDB:7k7uB	0.054	0.441	1.077E-15	187	0.036	0.316	7k7uB.pdb.gz
3	PDB:2nbrA	0.100	0.881	1.512E-15	173	0.039	0.370	2nbrA.pdb.gz
4	PDB:2v2uA	0.102	0.925	1.927E-15	173	0.036	0.347	2v2uA.pdb.gz
5	PDB:3lwkA	0.102	0.880	2.340E-15	182	0.040	0.363	3lwkA.pdb.gz
6	PDB:2kfbA	0.102	0.928	2.578E-15	174	0.037	0.356	2kfbA.pdb.gz
7	PDB:1zwmA	0.101	0.871	8.070E-14	177	0.033	0.311	1zwmA.pdb.gz
8	PDB:2m3tA	0.102	0.871	1.133E-13	178	0.034	0.320	2m3tA.pdb.gz
9	PDB:4iybA	0.072	0.701	1.174E-4	140	0.016	0.193	4iybA.pdb.gz	Macrolepiota procera ricin B-like lectin (MPL) in complex with galactose
10	AFDB:B7YZW3	0.037	0.033	2.196E-4	2064	0.116	0.093	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
11	PDB:1vclA	0.074	0.251	5.820E-4	432	0.033	0.127	1vclA.pdb.gz	Crystal Structure of the Hemolytic Lectin CEL-III Isolated from the Marine Invertebrate Cucumaria echinata: IMPLICATIONS OF DOMAIN STRUCTURE FOR ITS MEMBRANE PORE-FORMATION MECHANISM
12	AFDB:Q20684	0.047	0.054	1.291E-2	1245	0.114	0.152	Q20684.pdb.gz	Q20684_CAEEL Galectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lec-2 PE=1 SV=2
13	AFDB:E9Q4Y4	0.041	0.034	2.097E-2	2514	0.143	0.094	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
14	AFDB:B7Z0K1	0.038	0.051	2.202E-2	1137	0.100	0.146	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
15	AFDB:Q8TEP8	0.051	0.039	3.245E-2	2537	0.132	0.087	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
16	AFDB:Q86V38	0.027	0.031	4.557E-2	1191	0.119	0.166	Q86V38.pdb.gz	Q86V38_HUMAN Atrophin 1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=1
17	AFDB:Q9H2Y7	0.054	0.051	6.718E-2	1883	0.146	0.129	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
18	AFDB:O35413	0.037	0.046	1.145E-1	1196	0.119	0.165	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
19	AFDB:A0A0U1RQE4	0.039	0.053	1.391E-1	1047	0.122	0.193	A0A0U1RQE4.pdb.gz	A0A0U1RQE4_HUMAN SH3 domain containing 19 OS=Homo sapiens OX=9606 GN=SH3D19 PE=1 SV=1
20	AFDB:Q6XK20	0.040	0.053	2.742E-1	1102	0.093	0.140	Q6XK20.pdb.gz	Q6XK20_DROME Bitesize isoform 1 OS=Drosophila melanogaster OX=7227 GN=btsz PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68DQ2	6.13e-122	429	2970	0.157	0.088	CRBG3_HUMAN Very large A-kinase anchor protein OS=Homo sapiens OX=9606 GN=CRYBG3 PE=1 SV=3
2	P10067	8.17e-34	130	174	0.040	0.379	CRGD_RAT Gamma-crystallin D OS=Rattus norvegicus OX=10116 GN=Crygd PE=2 SV=2
3	P02528	5.59e-33	128	174	0.038	0.362	CRGE_RAT Gamma-crystallin E OS=Rattus norvegicus OX=10116 GN=Cryge PE=1 SV=2
4	P04342	1.09e-32	127	174	0.039	0.368	CRGD_MOUSE Gamma-crystallin D OS=Mus musculus OX=10090 GN=Crygd PE=2 SV=3
5	P10066	5.02e-32	125	175	0.036	0.343	CRGB_RAT Gamma-crystallin B OS=Rattus norvegicus OX=10116 GN=Crygb PE=3 SV=3
6	Q03740	8.96e-32	125	174	0.037	0.356	CRGE_MOUSE Gamma-crystallin E OS=Mus musculus OX=10090 GN=Cryge PE=2 SV=4
7	P07315	1.26e-31	124	174	0.039	0.368	CRGC_HUMAN Gamma-crystallin C OS=Homo sapiens OX=9606 GN=CRYGC PE=1 SV=2
8	P02529	3.57e-31	123	174	0.038	0.362	CRGC_RAT Gamma-crystallin C OS=Rattus norvegicus OX=10116 GN=Crygc PE=2 SV=4
9	P10068	6.44e-31	122	174	0.037	0.351	CRGF_RAT Gamma-crystallin F OS=Rattus norvegicus OX=10116 GN=Crygf PE=3 SV=2
10	P04344	1.54e-30	121	175	0.036	0.337	CRGB_MOUSE Gamma-crystallin B OS=Mus musculus OX=10090 GN=Crygb PE=2 SV=4
11	Q9CXV3	6.36e-30	119	174	0.036	0.345	CRGF_MOUSE Gamma-crystallin F OS=Mus musculus OX=10090 GN=Crygf PE=2 SV=3
12	Q61597	6.72e-29	116	174	0.036	0.345	CRGC_MOUSE Gamma-crystallin C OS=Mus musculus OX=10090 GN=Crygc PE=1 SV=3
13	P07320	2.62e-28	115	174	0.040	0.379	CRGD_HUMAN Gamma-crystallin D OS=Homo sapiens OX=9606 GN=CRYGD PE=1 SV=3
14	P04345	2.95e-28	115	174	0.038	0.362	CRGA_MOUSE Gamma-crystallin A OS=Mus musculus OX=10090 GN=Cryga PE=2 SV=2
15	P10065	3.94e-28	114	174	0.036	0.345	CRGA_RAT Gamma-crystallin A OS=Rattus norvegicus OX=10116 GN=Cryga PE=3 SV=3
16	P02523	8.09e-27	113	250	0.042	0.276	CRBB1_RAT Beta-crystallin B1 OS=Rattus norvegicus OX=10116 GN=Crybb1 PE=1 SV=4
17	O35486	2.08e-26	109	178	0.034	0.315	CRYGS_MOUSE Gamma-crystallin S OS=Mus musculus OX=10090 GN=Crygs PE=1 SV=3
18	P53674	2.78e-26	112	252	0.039	0.254	CRBB1_HUMAN Beta-crystallin B1 OS=Homo sapiens OX=9606 GN=CRYBB1 PE=1 SV=2
19	P62696	8.01e-26	108	205	0.038	0.307	CRBB2_MOUSE Beta-crystallin B2 OS=Mus musculus OX=10090 GN=Crybb2 PE=1 SV=2
20	P62697	8.01e-26	108	205	0.038	0.307	CRBB2_RAT Beta-crystallin B2 OS=Rattus norvegicus OX=10116 GN=Crybb2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00030 Crystall	3.7e-126	422.8	Beta/Gamma crystallin
2	PF08964 Crystall_3	18	16.9	Beta/Gamma crystallin
3	PF18258 IL4_i_Ig	0.025	26.1	Interleukin-4 inducing immunoglobulin-binding domain
4	PF00652 Ricin_B_lectin	0.0024	29.6	Ricin-type beta-trefoil lectin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310435

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482202	0.703	Phosphatidylinositol-glycan biosynthesis class W protein
2	9606.ENSP00000367154	0.685	Ras suppressor protein 1
3	9606.ENSP00000480832	0.664	NOP16 nucleolar protein
4	9606.ENSP00000310801	0.606	Protein LKAAEAR1
5	9606.ENSP00000363260	0.590	GPI mannosyltransferase 2
6	9606.ENSP00000476313	0.560	Olfactory receptor 8G1
7	9606.ENSP00000383392	0.547	Neural cell adhesion molecule 2
8	9606.ENSP00000360017	0.514	Zinc finger protein 280C
9	9606.ENSP00000401328	0.511	Serine protease 48
10	9606.ENSP00000352163	0.505	LY6/PLAUR domain containing 2
11	9606.ENSP00000381148	0.505	Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 2
12	9606.ENSP00000370224	0.502	Prostate androgen-regulated mucin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005212	0.739	structural constituent of eye lens

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0048856	0.759	anatomical structure development
GO:0065007	0.600	biological regulation
GO:0050789	0.557	regulation of biological process
GO:0050794	0.525	regulation of cellular process
GO:0048869	0.480	cellular developmental process
GO:0032501	0.460	multicellular organismal process
GO:0007275	0.331	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005737	0.969	cytoplasm
GO:0005634	0.962	nucleus
GO:0016020	0.961	membrane
GO:0043233	0.740	organelle lumen
GO:0070013	0.733	intracellular organelle lumen
GO:0071944	0.717	cell periphery
GO:0005654	0.555	nucleoplasm
GO:0005886	0.379	plasma membrane
GO:0005829	0.300	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]