StarFunc result for job id Q8N1Q8

User Input

>input (247 residues)
MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNA
SWCSDMLSLYQEFLEKTKSSGWIKLPSFKSNRDHIRGLKLPSGLAVSSDKGDCRIFTRCI
QVEGQGFEYVIFFQPTQKKSVCLFQPGSYLEGPPGFAHGGSLAAMMDETFSKTAFLAGEG
LFTLSLNIRFKNLIPVDSLVVMDVELDKIEDQKLYMSCIAHSRDQQTVYAKSSGVFLQLQ
LEEESPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N1Q8	1.000	1.000	2.126E-49	247	1.000	1.000	Q8N1Q8.pdb.gz	THEM5_HUMAN Acyl-coenzyme A thioesterase THEM5 OS=Homo sapiens OX=9606 GN=THEM5 PE=1 SV=2
2	AFDB:Q9CQJ0	0.899	0.896	1.658E-39	248	0.777	0.774	Q9CQJ0.pdb.gz	THEM5_MOUSE Acyl-coenzyme A thioesterase THEM5 OS=Mus musculus OX=10090 GN=Them5 PE=2 SV=1
3	AFDB:Q5T1C6	0.712	0.732	1.358E-21	240	0.356	0.367	Q5T1C6.pdb.gz	THEM4_HUMAN Acyl-coenzyme A thioesterase THEM4 OS=Homo sapiens OX=9606 GN=THEM4 PE=1 SV=1
4	AFDB:Q3UUI3	0.707	0.758	9.519E-21	230	0.336	0.361	Q3UUI3.pdb.gz	THEM4_MOUSE Acyl-coenzyme A thioesterase THEM4 OS=Mus musculus OX=10090 GN=Them4 PE=1 SV=1
5	AFDB:P40098	0.498	0.504	7.866E-10	244	0.170	0.172	P40098.pdb.gz	FMP10_YEAST Uncharacterized mitochondrial membrane protein FMP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FMP10 PE=1 SV=1
6	AFDB:Q9HDW5	0.493	0.477	2.022E-9	256	0.138	0.133	Q9HDW5.pdb.gz	YFW6_SCHPO UPF0644 protein PB2B4.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB2B4.06 PE=3 SV=2
7	AFDB:P38172	0.524	0.483	3.242E-9	270	0.130	0.119	P38172.pdb.gz	MRX3_YEAST MIOREX complex component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRX3 PE=1 SV=1
8	AFDB:O74793	0.472	0.650	3.648E-9	175	0.150	0.211	O74793.pdb.gz	YOUB_SCHPO Uncharacterized protein C26H8.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC26H8.11c PE=4 SV=1
9	AFDB:P34419	0.411	0.586	1.415E-7	169	0.073	0.107	P34419.pdb.gz	YLZ6_CAEEL Putative esterase F42H10.6 OS=Caenorhabditis elegans OX=6239 GN=F42H10.6 PE=1 SV=2
10	AFDB:P93828	0.368	0.573	7.387E-7	155	0.109	0.174	P93828.pdb.gz	P93828_ARATH F19P19.27 protein OS=Arabidopsis thaliana OX=3702 GN=At1g04290 PE=1 SV=1
11	PDB:2cy9B	0.370	0.655	1.100E-6	133	0.069	0.128	2cy9B.pdb.gz
12	PDB:4i82A	0.414	0.805	1.764E-6	121	0.073	0.149	4i82A.pdb.gz
13	PDB:2fs2B	0.400	0.695	2.233E-6	138	0.057	0.101	2fs2B.pdb.gz
14	PDB:3f5oA	0.372	0.647	2.513E-6	138	0.061	0.109	3f5oA.pdb.gz	The mechanisms of human hotdog-fold thioesterase 2 (hTHEM2) substrate recognition and catalysis illuminated by a structure and function based analysis
15	PDB:4ordA	0.383	0.665	2.513E-6	138	0.061	0.109	4ordA.pdb.gz
16	PDB:4k02A	0.378	0.685	1.762E-5	127	0.069	0.134	4k02A.pdb.gz
17	PDB:1q4sA	0.398	0.660	2.996E-5	142	0.065	0.113	1q4sA.pdb.gz	The Structure of 4-Hydroxybenzoyl-CoA Thioesterase from Arthrobacter sp. strain SU
18	PDB:1vh9A	0.394	0.667	3.371E-5	138	0.069	0.123	1vh9A.pdb.gz
19	PDB:1vi8B	0.372	0.611	4.528E-5	146	0.061	0.103	1vi8B.pdb.gz
20	PDB:1njkA	0.336	0.584	1.235E-4	133	0.053	0.098	1njkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N1Q8	0.0	511	247	1.000	1.000	THEM5_HUMAN Acyl-coenzyme A thioesterase THEM5 OS=Homo sapiens OX=9606 GN=THEM5 PE=1 SV=2
2	Q9CQJ0	2.57e-144	405	248	0.777	0.774	THEM5_MOUSE Acyl-coenzyme A thioesterase THEM5 OS=Mus musculus OX=10090 GN=Them5 PE=2 SV=1
3	Q5T1C6	1.86e-48	161	240	0.377	0.388	THEM4_HUMAN Acyl-coenzyme A thioesterase THEM4 OS=Homo sapiens OX=9606 GN=THEM4 PE=1 SV=1
4	Q3UUI3	2.47e-42	145	230	0.308	0.330	THEM4_MOUSE Acyl-coenzyme A thioesterase THEM4 OS=Mus musculus OX=10090 GN=Them4 PE=1 SV=1
5	O74793	0.30	33.9	175	0.126	0.177	YOUB_SCHPO Uncharacterized protein C26H8.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC26H8.11c PE=4 SV=1
6	Q95XZ5	0.95	33.1	2176	0.093	0.011	NIPBL_CAEEL Nipped-B-like protein scc-2 OS=Caenorhabditis elegans OX=6239 GN=scc-2 PE=1 SV=3
7	Q5AB84	1.3	32.7	400	0.085	0.052	Q5AB84_CANAL RRM domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C100160CA PE=4 SV=1
8	Q9SS53	1.7	32.3	876	0.081	0.023	Q9SS53_ARATH DNA mismatch repair protein MutS, type 2 OS=Arabidopsis thaliana OX=3702 GN=At1g65070 PE=1 SV=1
9	O04647	3.2	31.6	1038	0.061	0.014	PP399_ARATH Pentatricopeptide repeat-containing protein At5g27270 OS=Arabidopsis thaliana OX=3702 GN=EMB976 PE=2 SV=2
10	P38172	4.1	30.8	270	0.093	0.085	MRX3_YEAST MIOREX complex component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MRX3 PE=1 SV=1
11	Q8T443	6.3	30.4	470	0.138	0.072	Q8T443_DROME AT18578p OS=Drosophila melanogaster OX=7227 GN=Cht12 PE=2 SV=1
12	Q586A3	8.7	29.6	273	0.089	0.081	Q586A3_TRYB2 C3H1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.270 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03061 4HBT	0.0038	28.8	Thioesterase superfamily
2	PF17953 Csm4_C	5.8e+02	11.8	CRISPR Csm4 C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357807

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215567	0.902	Very-long-chain enoyl-CoA reductase
2	9606.ENSP00000238651	0.835	Acyl-coenzyme A thioesterase 2, mitochondrial
3	9606.ENSP00000323071	0.831	Acyl-coenzyme A thioesterase 4
4	9606.ENSP00000367086	0.823	Cytosolic acyl coenzyme A thioester hydrolase
5	9606.ENSP00000311224	0.819	Acyl-coenzyme A thioesterase 1
6	9606.ENSP00000357804	0.814	Acyl-coenzyme A thioesterase THEM4
7	9606.ENSP00000330432	0.702	Protein FAM83F
8	9606.ENSP00000378072	0.660	Patatin-like phospholipase domain-containing protein 1
9	9606.ENSP00000412999	0.648	Zinc finger protein 805
10	9606.ENSP00000284382	0.642	Ceramide synthase 3
11	9606.ENSP00000357810	0.642	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 4
12	9606.ENSP00000369853	0.631	C2 calcium dependent domain containing 2
13	9606.ENSP00000368605	0.604	Acyl-coenzyme A thioesterase 9, mitochondrial
14	9606.ENSP00000219334	0.591	Sphingomyelin phosphodiesterase 3
15	9606.ENSP00000302783	0.582	Trafficking protein particle complex subunit 1
16	9606.ENSP00000357796	0.556	S100 fused type protein family
17	9606.ENSP00000230048	0.539	Acyl-coenzyme A thioesterase 13
18	9606.ENSP00000263095	0.539	Zinc finger protein 264
19	9606.ENSP00000366945	0.520	Solute carrier family 25 member 51
20	9606.ENSP00000317895	0.515	Repetin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016290	1.000	palmitoyl-CoA hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.992	primary metabolic process
GO:0019637	0.989	organophosphate metabolic process
GO:0006796	0.988	phosphate-containing compound metabolic process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0044281	0.966	small molecule metabolic process
GO:0034641	0.963	cellular nitrogen compound metabolic process
GO:1901564	0.956	organonitrogen compound metabolic process
GO:1901360	0.955	organic cyclic compound metabolic process
GO:0006139	0.951	nucleobase-containing compound metabolic process
GO:0043603	0.926	amide metabolic process
GO:0006753	0.920	nucleoside phosphate metabolic process
GO:0072521	0.917	purine-containing compound metabolic process
GO:0006629	0.915	lipid metabolic process
GO:1901135	0.910	carbohydrate derivative metabolic process
GO:0009150	0.902	purine ribonucleotide metabolic process
GO:0035383	0.842	thioester metabolic process
GO:0033875	0.842	ribonucleoside bisphosphate metabolic process
GO:0034032	0.842	purine nucleoside bisphosphate metabolic process
GO:0006637	0.827	acyl-CoA metabolic process
GO:1901568	0.485	fatty acid derivative metabolic process
GO:0044255	0.440	cellular lipid metabolic process
GO:0035337	0.394	fatty-acyl-CoA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.995	intracellular organelle lumen
GO:0005759	0.665	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16645	1.000	H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate
EC:3.1.2.2	1.000	palmitoyl-CoA hydrolase.

[back to server]