StarFunc result for job id Q8N1T3

User Input

>input (1032 residues)
MEGALTARDKVGVQDFVLLDAYTSESAFVDNLRKRFSENLIYTYIGTLLVSVNPYQELGI
YTVSQMELYQGVNFFELPPHVYAIADNAYRMMCAELNNHFILISGESGAGKTEASKKILE
YFAVTCPMTQSLQIARDRLLFSNPVLEAFGNARTLRNDNSSRFGKYMDIQFDFQGIPVGG
HIISYLIEKSRVVYQNEGERNFHIFYQLLAGGEEERLSYLGLERDPQLYKYLSQGHCAKE
SSISDKNDWKTVSNAFSVIDFTEADLENLFGIIASVLHLGNIGFEEDDQGCATIPDTHEI
KWIAKLLGVHPSVLLEALTHRKIEAKTEEVICPLTLELSVYARDAMAKAVYGRTFTWLVN
KINSSLVNKVGQRILDPLLLLTWKTVIGLLDIYGFEVFDKNGFEQFCINYCNEKLQQLLI
ERTLKAEQAEYEMEGIEWEPIKYFNNKIICDLVEERHKGIISILDEECIRPGPATDLSFL
EKLEEKVGKHAHFETRKLAGPKGRKRIGWMEFRLLHYAGEVTYCTKGFLEKNNDLLYRHL
KEVLCKSKNIILRECFLLAELENRRRPPTVGTQFKNSLSSLLETLISKEPSYIRCIKPND
RKEPSKFDDFLIRHQIKYLGLMEHLRVRRAGFAYRRKYEHFLQRYKSLCPDTWPHWHGPP
AEGVERLIKYIGYKPEEYKLGKTKIFIRFPRTLFATEDAFEFSKHQLVARIQATYKRCLG
RREYVKKRQAAIKLEAHWRGALARKAIQRRKWAVRIIRKFIKGFISRNKPLCPDNEEFIV
FVRKNYILNLRYHLPKTVLDKSWLRPPGILENASDLLRKMCVRNLVQKYCRGITAERKAM
MQQKVVTSEIFRGRKDGYTESLNQPFVNSRIDEGDINPKVLQLISHEKIQYGVPVIKYDR
KGFKARQRQLILTQKAAYVVELAKIKQKIEYSALKGVSTSNLSDGILVIHVSPEDSKQKG
DAVLQCGHVFEAVTKLVMLVKKENIVNVVQGSLQFFISPGKEGTIVFDTGLEEQVYKNKN
GQLTVVSVRRKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286Y9H2	0.761	0.736	0.000	1069	0.623	0.601	A0A286Y9H2.pdb.gz	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
2	AFDB:A5PF48	0.645	0.649	0.000	1026	0.587	0.591	A5PF48.pdb.gz	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
3	AFDB:B8JLK6	0.699	0.723	0.000	993	0.647	0.673	B8JLK6.pdb.gz
4	AFDB:F1QKT3	0.602	0.626	0.000	990	0.578	0.603	F1QKT3.pdb.gz
5	AFDB:O00159	0.765	0.743	0.000	1063	0.603	0.585	O00159.pdb.gz	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
6	AFDB:Q23979	0.784	0.782	0.000	1035	0.495	0.494	Q23979.pdb.gz	MY61F_DROME Unconventional myosin IC OS=Drosophila melanogaster OX=7227 GN=Myo61F PE=1 SV=3
7	AFDB:P47807	0.668	0.660	1.438E-98	1045	0.397	0.392	P47807.pdb.gz	MYO1A_CHICK Unconventional myosin-Ia OS=Gallus gallus OX=9031 GN=MYO1A PE=1 SV=2
8	AFDB:O88329	0.655	0.648	4.190E-98	1043	0.395	0.391	O88329.pdb.gz	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
9	AFDB:Q9UBC5	0.661	0.654	6.366E-98	1043	0.393	0.389	Q9UBC5.pdb.gz	MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens OX=9606 GN=MYO1A PE=1 SV=1
10	AFDB:E9PDF6	0.641	0.599	2.386E-94	1107	0.423	0.395	E9PDF6.pdb.gz	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
11	PDB:4pa0A	0.563	0.595	3.873E-56	974	0.251	0.266	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4anjA	0.549	0.569	3.779E-55	995	0.251	0.260	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
13	PDB:4pa0B	0.575	0.642	1.923E-54	920	0.250	0.280	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:4p7hB	0.570	0.616	1.416E-51	952	0.244	0.265	4p7hB.pdb.gz
15	PDB:6ycxB	0.557	0.696	5.985E-51	817	0.217	0.274	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
16	PDB:7mf3B	0.554	0.631	9.432E-43	896	0.266	0.306	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.516	0.553	7.276E-40	954	0.271	0.294	5tbyA.pdb.gz
18	PDB:4mk0A	0.072	0.114	1.031E-2	631	0.015	0.024	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
19	PDB:4mt6A	0.086	0.184	1.801E-2	389	0.024	0.064	4mt6A.pdb.gz
20	PDB:5yqrA	0.086	0.297	2.169E-2	268	0.029	0.112	5yqrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A286Y9H2	1333	1069	0.625	0.603	A0A286Y9H2_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1cb PE=3 SV=2
2	A0A2R8Q9G7	1330	1068	0.625	0.604	A0A2R8Q9G7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=fj81f11 PE=1 SV=1
3	A0A3B3IU30	625	967	0.383	0.408	A0A3B3IU30_HUMAN Myosin IG OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=1
4	A5PF48	1241	1026	0.589	0.593	MYO1C_DANRE Unconventional myosin-Ic OS=Danio rerio OX=7955 GN=myo1c PE=3 SV=1
5	B0I1S9	718	1136	0.355	0.322	B0I1S9_HUMAN MYO1B variant protein OS=Homo sapiens OX=9606 GN=MYO1B PE=2 SV=1
6	B0I1T2	624	1018	0.383	0.388	MYO1G_HUMAN Unconventional myosin-Ig OS=Homo sapiens OX=9606 GN=MYO1G PE=1 SV=2
7	E7F5R7	1332	1043	0.625	0.618	E7F5R7_DANRE Myosin Ic, paralog b OS=Danio rerio OX=7955 GN=myo1c PE=1 SV=3
8	E7F9L8	643	1004	0.380	0.390	MYO1D_DANRE Unconventional myosin-Id OS=Danio rerio OX=7955 GN=myo1d PE=2 SV=1
9	E7FDV0	586	1117	0.303	0.280	E7FDV0_DANRE Myosin IEa OS=Danio rerio OX=7955 GN=myo1ea PE=3 SV=1
10	E9PDF6	746	1107	0.418	0.389	E9PDF6_HUMAN Myosin IB OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=1
11	E9Q634	586	1107	0.313	0.292	MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus OX=10090 GN=Myo1e PE=1 SV=1
12	F1PRN2	675	1006	0.412	0.422	MYO1D_CANLF Unconventional myosin-Id OS=Canis lupus familiaris OX=9615 GN=MYO1D PE=1 SV=2
13	F5H6E2	1323	1039	0.606	0.602	F5H6E2_HUMAN Myosin IC OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=1
14	O00159	1321	1063	0.606	0.588	MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens OX=9606 GN=MYO1C PE=1 SV=4
15	O00160	604	1098	0.307	0.289	MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens OX=9606 GN=MYO1F PE=1 SV=3
16	O43795	718	1136	0.355	0.322	MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B PE=1 SV=3
17	O88329	738	1043	0.392	0.388	MYO1A_MOUSE Unconventional myosin-Ia OS=Mus musculus OX=10090 GN=Myo1a PE=2 SV=2
18	O94832	674	1006	0.411	0.421	MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2
19	P22467	578	994	0.322	0.334	MYOA_DICDI Myosin IA heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoA PE=3 SV=2
20	P34092	580	1111	0.307	0.285	MYOB_DICDI Myosin IB heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00063 Myosin_head	3.1e-231	781.0	Myosin head (motor domain)
2	PF06017 Myosin_TH1	2.2e-23	94.4	Unconventional myosin tail, actin- and lipid-binding
3	PF06414 Zeta_toxin	2.3e+02	12.6	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000009198

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000032930	0.664	Bromodomain adjacent to zinc finger domain, 1B
2	9598.ENSPTRP00000058195	0.641	Uncharacterized protein
3	9598.ENSPTRP00000027500	0.604	Uncharacterized protein
4	9598.ENSPTRP00000028080	0.603	Uncharacterized protein
5	9598.ENSPTRP00000027605	0.602	Uncharacterized protein
6	9598.ENSPTRP00000042972	0.594	Uncharacterized protein
7	9598.ENSPTRP00000038250	0.592	KIAA1210
8	9598.ENSPTRP00000028278	0.572	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
9	9598.ENSPTRP00000044167	0.567	Uncharacterized protein
10	9598.ENSPTRP00000044466	0.561	Catenin (Cadherin-associated protein), beta 1, 88kDa
11	9598.ENSPTRP00000014897	0.558	Myosin, heavy chain 10, non-muscle
12	9598.ENSPTRP00000033278	0.555	Actin-related protein 2/3 complex subunit
13	9598.ENSPTRP00000056809	0.547	Uncharacterized protein
14	9598.ENSPTRP00000033275	0.546	Actin-related protein 2/3 complex subunit
15	9598.ENSPTRP00000024645	0.536	Myosin, heavy chain 9, non-muscle
16	9598.ENSPTRP00000027652	0.534	Uncharacterized protein
17	9598.ENSPTRP00000004431	0.533	DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
18	9598.ENSPTRP00000012382	0.532	Myosin IXA
19	9598.ENSPTRP00000002305	0.530	Uncharacterized protein
20	9598.ENSPTRP00000020591	0.530	ARP2 actin related protein 2 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003774	0.986	cytoskeletal motor activity
GO:0008092	0.974	cytoskeletal protein binding
GO:0003779	0.955	actin binding
GO:0140657	0.933	ATP-dependent activity
GO:0000146	0.905	microfilament motor activity
GO:0043167	0.881	ion binding
GO:0043168	0.852	anion binding
GO:0044877	0.805	protein-containing complex binding
GO:0097159	0.655	organic cyclic compound binding
GO:1901363	0.647	heterocyclic compound binding
GO:0008289	0.625	lipid binding
GO:0005543	0.514	phospholipid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.906	cellular process
GO:0032502	0.843	developmental process
GO:0048856	0.825	anatomical structure development
GO:0032501	0.514	multicellular organismal process
GO:0050789	0.340	regulation of biological process
GO:0050794	0.309	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.997	intracellular organelle
GO:0071944	0.996	cell periphery
GO:0043227	0.993	membrane-bounded organelle
GO:0005829	0.972	cytosol
GO:0016020	0.966	membrane
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0043232	0.949	intracellular non-membrane-bounded organelle
GO:0005886	0.947	plasma membrane
GO:0005634	0.895	nucleus
GO:0042995	0.811	cell projection
GO:0005856	0.762	cytoskeleton
GO:0120025	0.755	plasma membrane bounded cell projection
GO:0098862	0.709	cluster of actin-based cell projections
GO:0031974	0.674	membrane-enclosed lumen
GO:0031982	0.663	vesicle
GO:0043233	0.657	organelle lumen
GO:0070013	0.651	intracellular organelle lumen
GO:0015629	0.619	actin cytoskeleton
GO:0031981	0.616	nuclear lumen
GO:0005576	0.570	extracellular region
GO:0032991	0.527	protein-containing complex
GO:0005654	0.524	nucleoplasm
GO:0070062	0.412	extracellular exosome
GO:0030054	0.407	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.905	myosin ATPase.

[back to server]