StarFunc result for job id Q8N1W1

User Input

>input (1705 residues)
MELSCSEAPLYGQMMIYAKFDKNVYLPEDAEFYFTYDGSHQRHVMIAERIEDNVLQSSVP
GHGLQETVTVSVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQANRLTACSHQTLLT
PFALTAGALPALDEELVLALTHLELPLEWTVLGSSSLEVSSHRESLLHLAMRWGLAKLSQ
FFLCLPGGVQALALPNEEGATPLDLALREGHSKLVEDVTNFQGRWSPSFSRVQLSEEASL
HYIHSSETLTLTLNHTAEHLLEADIKLFRKYFWDRAFLVKAFEPEARPEERTAMPSSGAE
TEEEIKNSVSSRSAAEKEDIKRVKSLVVQHNEHEDQHSLDLDRSFDILKKSKPPSTLLAA
GRLSDMLNGGDEVYANCMVIDQVGDLDISYINIEGITATTSPESRGCTLWPQSSKHTLPT
ETSPSVYPLSENVEGTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLD
ALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNISRAESLPLSS
NLQSKESLLSGVRSRSYSCSSPKISLGKTRLVRELTVCSSSEEQRAYSLSEPPRENRIQE
EEWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKSKDAKDKEKLNRHQFAPGTF
SGVLQCLVCDKTLLGKESLQCSNCNANVHKGCKDAAPACTKKFQEKYNKNKPQTILGNSS
FRDIPQPGLSLHPSSSVPVGLPTGRRETVGQVHPLSRSVPGTTLESFRRSATSLESESDH
NSCRSRSHSDELLQSMGSSPSTESFIMEDVVDSSLWSDLSSDAQEFEAESWSLVVDPSFC
NRQEKDVIKRQDVIFELMQTEMHHIQTLFIMSEIFRKGMKEELQLDHSTVDKIFPCLDEL
LEIHRHFFYSMKERRQESCAGSDRNFVIDRIGDILVQQFSEENASKMKKIYGEFCCHHKE
AVNLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKER
TEEHKDLRKALCLIKDMIATVDLKVNEYEKNQKWLEILNKIENKTYTKLKNGHVFRKQAL
MSEERTLLYDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQK
LIAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEKGGRTSE
SDEDKRKAEARVAKIQQCQEILTNQDQQICAYLEEKLHIYAELGELSGFEDVHLEPHLLI
KPDPGEPPQAASLLAAALKEAESLQVAVKASQMGAVSQSCEDSCGDSVLADTLSSHDVPG
SPTASLVTGGREGRGCSDVDPGIQGVVTDLAVSDAGEKVECRNFPGSSQSEIIQAIQNLT
RLLYSLQAALTIQDSHIEIHRLVLQQQEGLSLGHSILRGGPLQDQKSRDADRQHEELANV
HQLQHQLQQEQRRWLRRCEQQQRAQATRESWLQERERECQSQEELLLRSRGELDLQLQEY
QHSLERLREGQRLVEREQARMRAQQSLLGHWKHGRQRSLPAVLLPGGPEVMELNRSESLC
HENSFFINEALVQMSFNTFNKLNPSVIHQDATYPTTQSHSDLVRTSEHQVDLKVDPSQPS
NVSHKLWTAAGSGHQILPFHESSKDSCKNDLDTSHTESPTPHDSNSHRPQLQAFITEAKL
NLPTRTMTRQDGETGDGAKENIVYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97433	0.311	0.313	0.000	1693	0.799	0.804	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
2	AFDB:Q8N1W1	1.000	1.000	0.000	1705	1.000	1.000	Q8N1W1.pdb.gz	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
3	AFDB:E9Q7D5	0.182	0.196	4.771E-16	1581	0.089	0.096	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
4	AFDB:Q8IQ97	0.172	0.220	3.994E-15	1311	0.100	0.130	Q8IQ97.pdb.gz	Q8IQ97_DROME Pebble, isoform B OS=Drosophila melanogaster OX=7227 GN=pbl PE=4 SV=1
5	AFDB:Q12774	0.179	0.190	1.156E-14	1597	0.085	0.091	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
6	PDB:7rx9A	0.105	0.391	4.905E-13	432	0.038	0.150	7rx9A.pdb.gz
7	PDB:4mt6A	0.151	0.534	8.344E-13	389	0.034	0.149	4mt6A.pdb.gz
8	AFDB:Q9VZ85	0.173	0.150	1.795E-10	1984	0.100	0.086	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
9	AFDB:X2JC00	0.138	0.164	4.548E-10	1404	0.087	0.106	X2JC00.pdb.gz	X2JC00_DROME Rho GTPase activating protein at 1A, isoform E OS=Drosophila melanogaster OX=7227 GN=RhoGAP1A PE=1 SV=1
10	AFDB:Q54DW7	0.170	0.284	2.140E-8	986	0.073	0.127	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
11	PDB:4gouA	0.106	0.302	1.415E-7	507	0.029	0.097	4gouA.pdb.gz
12	AFDB:A8DZ19	0.138	0.172	7.064E-6	1310	0.063	0.082	A8DZ19.pdb.gz	A8DZ19_DROME Rho-type guanine nucleotide exchange factor, isoform F OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
13	PDB:6bbpA	0.049	0.146	2.013E-4	520	0.025	0.081	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
14	PDB:6u3eA	0.056	0.191	2.013E-4	397	0.028	0.121	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	AFDB:P34333	0.039	0.037	3.968E-4	1778	0.116	0.111	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
16	PDB:6hhgA	0.056	0.232	5.100E-4	386	0.008	0.036	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:6s9wA	0.056	0.215	1.036E-3	411	0.008	0.034	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.
18	PDB:3ljuX	0.055	0.219	1.292E-3	373	0.007	0.032	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
19	PDB:4mk0A	0.057	0.139	3.274E-3	631	0.016	0.043	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:3m1iB	0.052	0.483	7.936E-3	131	0.012	0.153	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WZG4	0.0	618	1173	0.213	0.309	A0A087WZG4_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=3
2	A0A3B3IPE9	0.0	617	1119	0.217	0.331	A0A3B3IPE9_HUMAN Rho/Rac guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=2
3	A0A590UK10	0.0	635	1089	0.235	0.368	A0A590UK10_HUMAN Rho guanine nucleotide exchange factor 18 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=4 SV=1
4	F6P6M2	0.0	879	1753	0.373	0.363	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
5	P97433	0.0	2681	1700	0.808	0.810	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
6	Q6ZSZ5	0.0	635	1361	0.235	0.295	ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=4
7	Q8N1W1	0.0	3533	1705	1.000	1.000	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
8	F1QCK8	5.01e-175	557	1012	0.212	0.358	F1QCK8_DANRE Rho guanine nucleotide exchange factor 18 isoform X2 OS=Danio rerio OX=7955 GN=arhgef18b PE=1 SV=2
9	Q865S3	1.02e-162	523	986	0.204	0.352	ARHG2_CANLF Rho guanine nucleotide exchange factor 2 OS=Canis lupus familiaris OX=9615 GN=ARHGEF2 PE=1 SV=1
10	A0A087WTD7	5.29e-162	534	1429	0.215	0.256	A0A087WTD7_HUMAN A-kinase anchoring protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=1
11	A8MYJ1	7.53e-162	533	1434	0.215	0.255	A8MYJ1_HUMAN A-kinase anchoring protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=3
12	F1RLP5	8.85e-161	518	987	0.201	0.347	F1RLP5_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa OX=9823 GN=ARHGEF2 PE=4 SV=4
13	F7BYT9	2.61e-160	524	1245	0.201	0.275	F7BYT9_MACMU Rho guanine nucleotide exchange factor 2 OS=Macaca mulatta OX=9544 GN=ARHGEF2 PE=4 SV=3
14	E9Q394	3.64e-160	545	2776	0.223	0.137	AKP13_MOUSE A-kinase anchor protein 13 OS=Mus musculus OX=10090 GN=Akap13 PE=1 SV=1
15	B2DCZ9	1.43e-159	514	961	0.200	0.355	ARHG2_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa OX=9823 GN=ARHGEF2 PE=2 SV=1
16	Q92974	2.15e-157	509	986	0.197	0.341	ARHG2_HUMAN Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2 PE=1 SV=4
17	Q12802	1.84e-156	535	2813	0.213	0.129	AKP13_HUMAN A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2
18	Q60875	2.93e-154	500	985	0.198	0.343	ARHG2_MOUSE Rho guanine nucleotide exchange factor 2 OS=Mus musculus OX=10090 GN=Arhgef2 PE=1 SV=4
19	Q5FVC2	6.97e-154	499	985	0.199	0.344	ARHG2_RAT Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Arhgef2 PE=1 SV=1
20	F1M3G7	1.24e-152	523	2760	0.219	0.136	AKP13_RAT A-kinase anchor protein 13 OS=Rattus norvegicus OX=10116 GN=Akap13 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.00041	31.5	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	65	15.3	C1 domain
3	PF00169 PH	0.058	25.3	PH domain
4	PF00628 PHD	93	14.4	PHD-finger
5	PF16652 PH_13	9e+02	11.2	Pleckstrin homology domain
6	PF17838 PH_16	1.3e-35	133.4	PH domain
7	PF14446 Prok-RING_1	3.5e+02	12.6	Prokaryotic RING finger family 1
8	PF00621 RhoGEF	6.4e-26	103.2	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000441913

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.990	Transforming protein RhoA
2	9606.ENSP00000341189	0.970	Focal adhesion kinase 1
3	9606.ENSP00000380942	0.921	Rho guanine nucleotide exchange factor 12
4	9606.ENSP00000286548	0.878	Guanine nucleotide-binding protein G(q) subunit alpha
5	9606.ENSP00000337261	0.866	Rho guanine nucleotide exchange factor 1
6	9606.ENSP00000380638	0.861	Protein-tyrosine kinase 2-beta
7	9606.ENSP00000241014	0.831	C-Jun-amino-terminal kinase-interacting protein 1
8	9606.ENSP00000382697	0.791	Rho-associated protein kinase 1
9	9606.ENSP00000317985	0.781	Rho-associated protein kinase 2
10	9606.ENSP00000221166	0.766	Neurofilament medium polypeptide
11	9606.ENSP00000482169	0.735	Neurofilament light polypeptide
12	9606.ENSP00000378557	0.712	Disheveled-associated activator of morphogenesis 1
13	9606.ENSP00000307134	0.702	Catenin delta-2
14	9606.ENSP00000267257	0.693	Paxillin
15	9606.ENSP00000340297	0.692	Rho guanine nucleotide exchange factor 10
16	9606.ENSP00000367638	0.692	Rho guanine nucleotide exchange factor 39
17	9606.ENSP00000385720	0.683	Rho GTPase-activating protein 35
18	9606.ENSP00000383118	0.678	Cell division control protein 42 homolog
19	9606.ENSP00000240874	0.676	Kalirin
20	9606.ENSP00000441140	0.665	Nucleolar protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0019899	0.430	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0023051	0.987	regulation of signaling
GO:0048583	0.985	regulation of response to stimulus
GO:0010646	0.984	regulation of cell communication
GO:0007154	0.966	cell communication
GO:0023052	0.963	signaling
GO:0051716	0.957	cellular response to stimulus
GO:1902531	0.950	regulation of intracellular signal transduction
GO:0007165	0.949	signal transduction
GO:0051056	0.938	regulation of small GTPase mediated signal transduction
GO:0071840	0.768	cellular component organization or biogenesis
GO:0016043	0.668	cellular component organization
GO:0007166	0.657	cell surface receptor signaling pathway
GO:0048856	0.370	anatomical structure development
GO:0032501	0.363	multicellular organismal process
GO:0006996	0.330	organelle organization
GO:0007169	0.301	transmembrane receptor protein tyrosine kinase signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.397	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]