StarFunc result for job id Q8N201

User Input

>input (2190 residues)
MNRAKPTTVRRPSAAAKPSGHPPPGDFIALGSKGQANESKTASTLLKPAPSGLPSERKRD
AAAALSSASALTGLTKRPKLSSTPPLSALGRLAEAAVAEKRAISPSIKEPSVVPIEVLPT
VLLDEIEAAELEGNDDRIEGVLCGAVKQLKVTRAKPDSTLYLSLMYLAKIKPNIFATEGV
IEALCSLLRRDASINFKAKGNSLVSVLACNLLMAAYEEDENWPEIFVKVYIEDSLGERIW
VDSPHCKTFVDNIQTAFNTRMPPRSVLLQGEAGRVAGDLGAGSSPHPSLTEEEDSQTELL
IAEEKLSPEQEGQLMPRYEELAESVEEYVLDMLRDQLNRRQPIDNVSRNLLRLLTSTCGY
KEVRLLAVQKLEMWLQNPKLTRPAQDLLMSVCMNCNTHGSEDMDVISHLIKIRLKPKVLL
NHFMLCIRELLSAHKDNLGTTIKLVIFNELSSARNPNNMQVLYTALQHSSELAPKFLAMV
FQDLLTNKDDYLRASRALLREIIKQTKHEINFQAFCLGLMQERKEPQYLEMEFKERFVVH
ITDVLAVSMMLGITAQVKEAGIAWDKGEKRNLEVLRSFQNQIAAIQRDAVWWLHTVVPSI
SKLAPKDYVHCLHKVLFTEQPETYYKWDNWPPESDRNFFLRLCSEVPILEDTLMRILVIG
LSRELPLGPADAMELADHLVKRAAAVQADDVEVLKVGRTQLIDAVLNLCTYHHPENIQLP
PGYQPPNLAISTLYWKAWPLLLVVAAFNPENIGLAAWEEYPTLKMLMEMVMTNNYSYPPC
TLTDEETRTEMLNRELQTAQREKQEILAFEGHLAAASTKQTITESSSLLLSQLTSLDPQG
PPRRPPPHILDQVKSLNQSLRLGHLLCRSRNPDFLLHIIQRQASSQSMPWLADLVQSSEG
SLDVLPVQCLCEFLLHDAVDDAASGEEDDEGESKEQKAKKRQRQQKQRQLLGRLQDLLLG
PKADEQTTCEVLDYFLRRLGSSQVASRVLAMKGLSLVLSEGSLRDGEEKEPPMEEDVGDT
DVLQGYQWLLRDLPRLPLFDSVRSTTALALQQAIHMETDPQTISAYLIYLSQHTPVEEQA
QHSDLALDVARLVVERSTIMSHLFSKLSPSAASDAVLSALLSIFSRYVRRMRQSKEGEEV
YSWSESQDQVFLRWSSGETATMHILVVHAMVILLTLGPPRADDSEFQALLDIWFPEEKPL
PTAFLVDTSEEALLLPDWLKLRMIRSEVLRLVDAALQDLEPQQLLLFVQSFGIPVSSMSK
LLQFLDQAVAHDPQTLEQNIMDKNYMAHLVEVQHERGASGGQTFHSLLTASLPPRRDSTE
APKPKSSPEQPIGQGRIRVGTQLRVLGPEDDLAGMFLQIFPLSPDPRWQSSSPRPVALAL
QQALGQELARVVQGSPEVPGITVRVLQALATLLSSPHGGALVMSMHRSHFLACPLLRQLC
QYQRCVPQDTGFSSLFLKVLLQMLQWLDSPGVEGGPLRAQLRMLASQASAGRRLSDVRGG
LLRLAEALAFRQDLEVVSSTVRAVIATLRSGEQCSVEPDLISKVLQGLIEVRSPHLEELL
TAFFSATADAASPFPACKPVVVVSSLLLQEEEPLAGGKPGADGGSLEAVRLGPSSGLLVD
WLEMLDPEVVSSCPDLQLRLLFSRRKGKGQAQVPSFRPYLLTLFTHQSSWPTLHQCIRVL
LGKSREQRFDPSASLDFLWACIHVPRIWQGRDQRTPQKRREELVLRVQGPELISLVELIL
AEAETRSQDGDTAACSLIQARLPLLLSCCCGDDESVRKVTEHLSGCIQQWGDSVLGRRCR
DLLLQLYLQRPELRVPVPEVLLHSEGAASSSVCKLDGLIHRFITLLADTSDSRALENRGA
DASMACRKLAVAHPLLLLRHLPMIAALLHGRTHLNFQEFRQQNHLSCFLHVLGLLELLQP
HVFRSEHQGALWDCLLSFIRLLLNYRKSSRHLAAFINKFVQFIHKYITYNAPAAISFLQK
HADPLHDLSFDNSDLVMLKSLLAGLSLPSRDDRTDRGLDEEGEEESSAGSLPLVSVSLFT
PLTAAEMAPYMKRLSRGQTVEDLLEVLSDIDEMSRRRPEILSFFSTNLQRLMSSAEECCR
NLAFSLALRSMQNSPSIAAAFLPTFMYCLGSQDFEVVQTALRNLPEYALLCQEHAAVLLH
RAFLVGMYGQMDPSAQISEALRILHMEAVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P4S8	0.398	0.397	0.000	2195	0.903	0.901	Q6P4S8.pdb.gz	INT1_MOUSE Integrator complex subunit 1 OS=Mus musculus OX=10090 GN=Ints1 PE=1 SV=2
2	AFDB:Q9W1C5	0.580	0.611	7.956E-103	2053	0.300	0.321	Q9W1C5.pdb.gz	INT1_DROME Integrator complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=IntS1 PE=1 SV=2
3	PDB:7pksa	0.250	0.407	3.467E-90	1227	0.557	0.994	7pksa.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
4	PDB:7cunA	0.227	0.601	1.839E-43	730	0.332	0.997	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
5	PDB:7mqaLM	0.100	0.103	2.872E-10	2041	0.111	0.120	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:6x9oA	0.091	0.085	6.241E-10	2425	0.124	0.112	6x9oA.pdb.gz
7	PDB:7mq8LM	0.107	0.113	3.293E-9	2005	0.109	0.119	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:7su3A	0.124	0.090	3.817E-9	3802	0.133	0.077	7su3A.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
9	PDB:7mq8SP	0.090	0.094	6.172E-9	1993	0.120	0.131	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7mqaSP	0.104	0.097	8.296E-9	2485	0.136	0.120	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:7otmA	0.094	0.068	9.979E-9	3656	0.137	0.082	7otmA.pdb.gz	Structural insights into inhibitor regulation of the DNA repair protein DNA-PKcs.
12	PDB:7ajuUT	0.115	0.112	1.613E-8	2313	0.110	0.104	7ajuUT.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
13	AFDB:Q19317	0.105	0.096	1.049E-4	2507	0.100	0.087	Q19317.pdb.gz	NBEA_CAEEL Putative neurobeachin homolog OS=Caenorhabditis elegans OX=6239 GN=sel-2 PE=2 SV=3
14	AFDB:Q10429	0.069	0.137	1.262E-4	875	0.050	0.126	Q10429.pdb.gz	CND3_SCHPO Condensin complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd3 PE=1 SV=1
15	AFDB:Q14669	0.100	0.106	2.197E-4	1992	0.117	0.129	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
16	AFDB:E7FB07	0.096	0.159	2.366E-4	1047	0.052	0.109	E7FB07.pdb.gz	E7FB07_DANRE Armadillo repeat containing 4 OS=Danio rerio OX=7955 GN=armc4 PE=1 SV=1
17	AFDB:Q4QJ74	0.060	0.180	2.712E-3	470	0.034	0.157	Q4QJ74.pdb.gz	Q4QJ74_LEIMA Putative pumillio protein 5 OS=Leishmania major OX=5664 GN=PUF5 PE=4 SV=1
18	AFDB:Q2QCI8	0.083	0.083	4.722E-3	2173	0.089	0.090	Q2QCI8.pdb.gz	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
19	AFDB:Q7TPV4	0.089	0.118	6.346E-3	1344	0.082	0.133	Q7TPV4.pdb.gz	MBB1A_MOUSE Myb-binding protein 1A OS=Mus musculus OX=10090 GN=Mybbp1a PE=1 SV=2
20	AFDB:A0A1D8PTY4	0.069	0.108	8.220E-3	1195	0.044	0.081	A0A1D8PTY4.pdb.gz	A0A1D8PTY4_CANAL Elf1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ELF1 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P4S8	0.0	3868	2195	0.903	0.901	INT1_MOUSE Integrator complex subunit 1 OS=Mus musculus OX=10090 GN=Ints1 PE=1 SV=2
2	Q8N201	0.0	4458	2190	1.000	1.000	INT1_HUMAN Integrator complex subunit 1 OS=Homo sapiens OX=9606 GN=INTS1 PE=1 SV=2
3	Q9W1C5	0.0	850	2053	0.224	0.239	INT1_DROME Integrator complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=IntS1 PE=1 SV=2
4	P32366	0.082	40.0	345	0.019	0.119	VA0D_YEAST V-type proton ATPase subunit d OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA6 PE=1 SV=2
5	P04020	0.83	34.3	98	0.007	0.163	VE7_HPV11 Protein E7 OS=Human papillomavirus 11 OX=10580 GN=E7 PE=1 SV=1
6	Q9JJN2	1.8	36.2	3550	0.014	0.009	ZFHX4_MOUSE Zinc finger homeobox protein 4 OS=Mus musculus OX=10090 GN=Zfhx4 PE=1 SV=1
7	Q80TZ3	4.7	34.7	938	0.020	0.046	AUXI_MOUSE Putative tyrosine-protein phosphatase auxilin OS=Mus musculus OX=10090 GN=Dnajc6 PE=1 SV=2
8	Q8BI71	7.3	34.3	739	0.008	0.024	EX3L1_MOUSE Exocyst complex component 3-like protein OS=Mus musculus OX=10090 GN=Exoc3l1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12432 DUF3677	1.9e-28	109.8	Protein of unknown function (DUF3677)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385722

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355961	0.998	Integrator complex subunit 7
2	9606.ENSP00000414237	0.998	Integrator complex subunit 2
3	9606.ENSP00000445001	0.997	Integrator complex subunit 11
4	9606.ENSP00000415433	0.996	Integrator complex subunit 12
5	9606.ENSP00000429065	0.996	Integrator complex subunit 9
6	9606.ENSP00000434466	0.996	Integrator complex subunit 4
7	9606.ENSP00000327889	0.995	Integrator complex subunit 5
8	9606.ENSP00000430338	0.995	Integrator complex subunit 8
9	9606.ENSP00000261191	0.994	Integrator complex subunit 13
10	9606.ENSP00000310260	0.994	Integrator complex subunit 6
11	9606.ENSP00000408429	0.989	Integrator complex subunit 14
12	9606.ENSP00000381064	0.985	Integrator complex subunit 10
13	9606.ENSP00000318641	0.983	Integrator complex subunit 3
14	9606.ENSP00000480158	0.937	DNA-directed RNA polymerase II subunit RPB1
15	9606.ENSP00000418447	0.934	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
16	9606.ENSP00000301732	0.822	ATP-binding cassette sub-family A member 3
17	9606.ENSP00000380019	0.821	Zinc finger protein 384
18	9606.ENSP00000265806	0.817	R3H domain and coiled-coil containing 1
19	9606.ENSP00000356437	0.817	SAM and SH3 domain-containing protein 1
20	9606.ENSP00000367823	0.817	Protein FAM214B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.988	organic substance metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0044238	0.985	primary metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0043170	0.978	macromolecule metabolic process
GO:0006139	0.946	nucleobase-containing compound metabolic process
GO:0090304	0.941	nucleic acid metabolic process
GO:0010467	0.913	gene expression
GO:0016070	0.908	RNA metabolic process
GO:0016180	0.848	snRNA processing
GO:0050789	0.603	regulation of biological process
GO:0050794	0.502	regulation of cellular process
GO:0019222	0.310	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:0016020	0.983	membrane
GO:0140513	0.967	nuclear protein-containing complex
GO:0005737	0.751	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]