StarFunc result for job id Q8N205

User Input

>input (404 residues)
MALSLPLGPRLGSEPLNHPPGAPREADIVGCTVCPASGEESTSPEQAQTLGQDSLGPPEH
FQGGPRGNEPAAHPPRWSTPSSYEDPAGGKHCEHPISGLEVLEAEQNSLHLCLLGLGRRL
QDLEQGLGHWALAQSGMVQLQALQVDLRGAAERVEALLAFGEGLAQRSEPRAWAALEQIL
RALGAYRDSIFRRLWQLQAQLVSYSLVFEEANTLDQDLEVEGDSDWPGPGGVWGPWAPSS
LPTSTELEWDPAGDIGGLGPLGQKTARTLGVPCELCGQRGPQGRGQGLEEADTSHSRQDM
LESGLGHQKRLARHQRHSLLRKPQDKKRQASPHLQDVRLEGNPGAPDPASRQPLTFLLIL
FLLFLLLVGAMFLLPASGGPCCSHARIPRTPYLVLSYVNGLPPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N205	1.000	1.000	3.805E-56	404	1.000	1.000	Q8N205.pdb.gz	SYNE4_HUMAN Nesprin-4 OS=Homo sapiens OX=9606 GN=SYNE4 PE=1 SV=2
2	AFDB:Q8CII8	0.526	0.546	2.772E-33	388	0.653	0.680	Q8CII8.pdb.gz	SYNE4_MOUSE Nesprin-4 OS=Mus musculus OX=10090 GN=Syne4 PE=1 SV=1
3	AFDB:A0A0R4IR86	0.102	0.033	3.689E-3	1799	0.171	0.038	A0A0R4IR86.pdb.gz	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1
4	AFDB:Q5T626	0.217	0.198	6.566E-3	449	0.094	0.085	Q5T626.pdb.gz	Q5T626_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=2 SV=1
5	AFDB:Q923U0	0.174	0.154	9.281E-3	474	0.129	0.110	Q923U0.pdb.gz	TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus OX=10090 GN=Tom1l1 PE=1 SV=1
6	AFDB:Q500P4	0.161	0.188	9.832E-3	338	0.099	0.118	Q500P4.pdb.gz	Q500P4_PSEU2 Alginate regulatory protein AlgR3 OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=Psyr_0054 PE=4 SV=1
7	AFDB:Q5BBH9	0.252	0.108	1.559E-2	1010	0.099	0.040	Q5BBH9.pdb.gz	Q5BBH9_EMENI KAR9-domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02101 PE=4 SV=1
8	AFDB:Q75JD4	0.162	0.126	2.940E-2	533	0.089	0.068	Q75JD4.pdb.gz	Y1676_DICDI SH3 and F-BAR domain-containing protein DDB_G0271676 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271676 PE=4 SV=1
9	AFDB:D5LXJ0	0.138	0.088	3.496E-2	691	0.213	0.124	D5LXJ0.pdb.gz	CIP73_LOTJA Ubiquitin-like domain-containing protein CIP73 OS=Lotus japonicus OX=34305 GN=CIP73 PE=1 SV=1
10	AFDB:P20134	0.124	0.073	3.703E-2	766	0.101	0.054	P20134.pdb.gz	SFL1_YEAST Flocculation suppression protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SFL1 PE=1 SV=3
11	PDB:3euhB	0.147	0.176	1.517E-1	321	0.054	0.069	3euhB.pdb.gz
12	PDB:3jcfA	0.263	0.302	2.145E-1	349	0.040	0.046	3jcfA.pdb.gz
13	PDB:6wczA	0.127	0.143	3.604E-1	350	0.050	0.057	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.
14	PDB:7nsuD	0.117	0.112	3.604E-1	420	0.052	0.050	7nsuD.pdb.gz
15	PDB:5ynxA	0.182	0.521	3.817E-1	117	0.047	0.162	5ynxA.pdb.gz
16	PDB:7ajuUL	0.120	0.073	4.284E-1	779	0.050	0.026	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:7q83D	0.187	0.398	4.538E-1	156	0.045	0.115	7q83D.pdb.gz
18	PDB:4e6kA	0.152	0.318	5.093E-1	157	0.040	0.102	4e6kA.pdb.gz	The Structure of the BfrB-Bfd Complex Reveals Protein-Protein Interactions Enabling Iron Release from Bacterioferritin.
19	PDB:6n3qF	0.065	0.123	5.093E-1	190	0.052	0.111	6n3qF.pdb.gz
20	PDB:6tuyA	0.146	0.096	5.395E-1	667	0.047	0.028	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N205	0.0	801	404	1.000	1.000	SYNE4_HUMAN Nesprin-4 OS=Homo sapiens OX=9606 GN=SYNE4 PE=1 SV=2
2	Q8CII8	3.78e-162	462	388	0.658	0.686	SYNE4_MOUSE Nesprin-4 OS=Mus musculus OX=10090 GN=Syne4 PE=1 SV=1
3	Q8WXH0	5.78e-07	54.3	6885	0.111	0.007	SYNE2_HUMAN Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3
4	A0A0C4DGK3	1.83e-06	52.8	3541	0.111	0.013	A0A0C4DGK3_HUMAN Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=1
5	Q6ZWQ0	5.88e-06	51.2	6874	0.111	0.007	SYNE2_MOUSE Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=2
6	Q6DFZ2	1.22e-05	50.1	2152	0.111	0.021	Q6DFZ2_MOUSE Spectrin repeat containing, nuclear envelope 2 (Fragment) OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=1
7	G3V5X4	3.79e-04	45.4	6818	0.099	0.006	G3V5X4_HUMAN Spectrin repeat containing nuclear envelope protein 2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=1
8	A2VEC9	3.6	32.7	5150	0.030	0.002	SSPO_HUMAN SCO-spondin OS=Homo sapiens OX=9606 GN=SSPOP PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10541 KASH	0.00057	31.3	Nuclear envelope localisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316130

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384015	0.977	SUN domain-containing protein 1
2	9606.ENSP00000385616	0.962	SUN domain-containing protein 2
3	9606.ENSP00000334308	0.912	Nesprin-3
4	9606.ENSP00000356224	0.878	Nesprin-1
5	9606.ENSP00000404220	0.878	Protein KASH5
6	9606.ENSP00000323856	0.715	Plectin
7	9606.ENSP00000363391	0.707	Sperm-associated antigen 4 protein
8	9606.ENSP00000348496	0.681	SUN domain-containing protein 5
9	9606.ENSP00000363590	0.671	Chondroitin sulfate N-acetylgalactosaminyltransferase 2
10	9606.ENSP00000327054	0.664	Lamin-B2
11	9606.ENSP00000346442	0.650	Lymphoid-restricted membrane protein
12	9606.ENSP00000281456	0.635	ADP/ATP translocase 1
13	9606.ENSP00000297325	0.633	SUN domain-containing protein 3
14	9606.ENSP00000358857	0.633	Emerin
15	9606.ENSP00000375810	0.628	Kinesin light chain 3
16	9606.ENSP00000261366	0.615	Lamin-B1
17	9606.ENSP00000357283	0.608	Prelamin-A/C
18	9606.ENSP00000350719	0.583	Nesprin-2
19	9606.ENSP00000368152	0.565	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6
20	9606.ENSP00000307078	0.555	Kinesin-1 heavy chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0032502	0.954	developmental process
GO:0048856	0.907	anatomical structure development
GO:0001738	0.879	morphogenesis of a polarized epithelium
GO:0007163	0.875	establishment or maintenance of cell polarity
GO:0030010	0.787	establishment of cell polarity
GO:0035088	0.784	establishment or maintenance of apical/basal cell polarity
GO:0030855	0.775	epithelial cell differentiation
GO:0061339	0.760	establishment or maintenance of monopolar cell polarity
GO:0045197	0.753	establishment or maintenance of epithelial cell apical/basal polarity
GO:0030859	0.729	polarized epithelial cell differentiation
GO:0090162	0.728	establishment of epithelial cell polarity
GO:0061162	0.483	establishment of monopolar cell polarity
GO:0065007	0.325	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	1.000	organelle membrane
GO:0005635	0.999	nuclear envelope
GO:0042175	0.991	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098588	0.991	bounding membrane of organelle
GO:0031965	0.989	nuclear membrane
GO:0031968	0.968	organelle outer membrane
GO:0005640	0.957	nuclear outer membrane
GO:0005737	0.774	cytoplasm
GO:0070013	0.397	intracellular organelle lumen
GO:0031981	0.340	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]