StarFunc result for job id Q8N264

User Input

>input (748 residues)
MEENNDSTENPQQGQGRQNAIKCGWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPL
GTIFLPGNKVSEHPCNEENPGKFLFEVVPGGDRDRMTANHESYLLMASTQNDMEDWVKSI
RRVIWGPFGGGIFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQA
NLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSK
EEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPK
VEDPLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSKPQDGVSNNNEIQKKATMGQLQN
KENNNTKDSPSRQCSWDKSESPQRSSMNNGSPTALSGSKTNSPKNSVHKLDVSRSPPLMV
KKNPAFNKGSGIVTNGSFSSSNAEGLEKTQTTPNGSLQARRSSSLKVSGTKMGTHSVQNG
TVRMGILNSDTLGNPTNVRNMSWLPNGYVTLRDNKQKEQAGELGQHNRLSTYDNVHQQFS
MMNLDDKQSIDSATWSTSSCEISLPENSNSCRSSTTTCPEQDFFGGNFEDPVLDGPPQDD
LSHPRDYESKSDHRSVGGRSSRATSSSDNSETFVGNSSSNHSALHSLVSSLKQEMTKQKI
EYESRIKSLEQRNLTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQK
EMEQFFSTFGELTVEPRRTERGNTIWIQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N264	1.000	1.000	8.266E-100	748	1.000	1.000	Q8N264.pdb.gz	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
2	AFDB:P42331	0.326	0.368	2.127E-40	645	0.362	0.420	P42331.pdb.gz	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
3	AFDB:D3ZFJ3	0.236	0.256	1.188E-16	689	0.128	0.139	D3ZFJ3.pdb.gz	3BP1_RAT SH3 domain-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3bp1 PE=1 SV=1
4	AFDB:Q17R89	0.268	0.246	3.065E-16	818	0.158	0.144	Q17R89.pdb.gz	RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens OX=9606 GN=ARHGAP44 PE=1 SV=1
5	AFDB:Q9VDS5	0.247	0.250	8.313E-16	740	0.147	0.149	Q9VDS5.pdb.gz	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
6	AFDB:Q8CGF1	0.260	0.157	5.265E-15	1266	0.143	0.085	Q8CGF1.pdb.gz	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
7	AFDB:Q68EM7	0.248	0.212	5.535E-15	881	0.146	0.124	Q68EM7.pdb.gz	RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1
8	AFDB:Q19370	0.253	0.181	9.581E-15	1059	0.156	0.110	Q19370.pdb.gz	Q19370_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=srgp-1 PE=1 SV=2
9	AFDB:D4A9G6	0.257	0.149	1.170E-14	1310	0.151	0.086	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
10	AFDB:Q54DW4	0.256	0.143	1.292E-14	1350	0.164	0.091	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
11	PDB:6r3vA	0.242	0.881	7.600E-14	198	0.075	0.283	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
12	PDB:3cxlA	0.267	0.477	2.923E-13	402	0.091	0.169	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	PDB:1xa6A	0.249	0.460	1.124E-12	399	0.080	0.150	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
14	PDB:5c2kA	0.233	0.443	2.478E-11	382	0.087	0.170	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
15	PDB:5jcpA	0.219	0.447	3.638E-9	361	0.057	0.119	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
16	PDB:6bbpA	0.136	0.193	1.460E-7	520	0.075	0.108	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
17	PDB:6u3eA	0.127	0.235	2.159E-6	397	0.049	0.093	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:3ljuX	0.121	0.236	6.801E-6	373	0.032	0.064	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
19	PDB:6hhgA	0.117	0.221	6.749E-5	386	0.032	0.062	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
20	PDB:4mk0A	0.124	0.145	1.006E-4	631	0.027	0.032	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8C4V1	0.0	1429	747	0.925	0.926	RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus OX=10090 GN=Arhgap24 PE=1 SV=2
2	Q8N264	0.0	1560	748	1.000	1.000	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
3	Q7Z5H3	3.20e-163	489	698	0.295	0.317	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
4	P42331	8.27e-124	386	645	0.262	0.304	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
5	Q17R89	1.26e-28	125	818	0.092	0.084	RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens OX=9606 GN=ARHGAP44 PE=1 SV=1
6	Q5SSM3	1.74e-28	124	814	0.094	0.086	RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus OX=10090 GN=Arhgap44 PE=1 SV=1
7	Q68EM7	3.17e-28	124	881	0.095	0.081	RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1
8	F1LQX4	3.36e-28	123	814	0.092	0.085	RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus OX=10116 GN=Arhgap44 PE=1 SV=2
9	Q99N37	1.22e-27	122	858	0.098	0.085	RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus OX=10116 GN=Arhgap17 PE=1 SV=1
10	Q3UIA2	1.51e-27	121	846	0.098	0.086	RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus OX=10090 GN=Arhgap17 PE=1 SV=1
11	O43295	4.74e-26	117	1099	0.080	0.055	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
12	Q6ZUM4	5.74e-26	116	889	0.092	0.078	RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens OX=9606 GN=ARHGAP27 PE=1 SV=3
13	P30337	9.04e-26	111	334	0.082	0.183	CHIN_RAT N-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn1 PE=1 SV=2
14	Q6TLK4	1.44e-25	115	869	0.088	0.076	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
15	Q54DW4	2.05e-25	115	1350	0.094	0.052	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
16	Q7Z6B7	3.21e-25	114	1085	0.087	0.060	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
17	Q91Z69	3.22e-25	114	1062	0.082	0.057	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
18	Q812A2	3.51e-25	114	1099	0.080	0.055	SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Srgap3 PE=1 SV=1
19	Q91V57	4.03e-25	111	459	0.082	0.133	CHIN_MOUSE N-chimaerin OS=Mus musculus OX=10090 GN=Chn1 PE=1 SV=2
20	Q9VDS5	1.79e-24	111	740	0.090	0.091	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	4.3	19.0	Autophagy protein 16 (ATG16)
2	PF19220 Crescentin	1.2e+02	13.2	Crescentin protein
3	PF11917 DUF3435	56	14.1	Protein of unknown function (DUF3435)
4	PF05911 FPP	40	13.9	Filament-like plant protein, long coiled-coil
5	PF00169 PH	1.2e-18	78.8	PH domain
6	PF15413 PH_11	0.17	23.7	Pleckstrin homology domain
7	PF20399 PH_20	0.0019	29.5	PH domain
8	PF00620 RhoGAP	2.5e-45	165.4	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378611

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358866	0.994	Filamin-A
2	9606.ENSP00000328848	0.903	RNA-binding protein 10
3	9606.ENSP00000295888	0.700	WD repeat and FYVE domain-containing protein 3
4	9606.ENSP00000389900	0.689	DCN1-like protein 4
5	9606.ENSP00000376410	0.684	Inverted formin-2
6	9606.ENSP00000390600	0.678	Sodium channel protein type 10 subunit alpha
7	9606.ENSP00000410041	0.675	Belongs to the DACH/dachshund family
8	9606.ENSP00000269321	0.674	Rho GDP-dissociation inhibitor 1
9	9606.ENSP00000383118	0.664	Cell division control protein 42 homolog
10	9606.ENSP00000400175	0.647	Transforming protein RhoA
11	9606.ENSP00000479664	0.641	Acyloxyacyl hydrolase
12	9606.ENSP00000222693	0.638	Caveolin-2
13	9606.ENSP00000424765	0.635	Angiomotin-like protein 2
14	9606.ENSP00000377941	0.634	Alpha-actinin-1
15	9606.ENSP00000433427	0.631	ADP-ribosylation factor-like protein 15
16	9606.ENSP00000264424	0.630	Guanylate cyclase soluble subunit beta-1
17	9606.ENSP00000308976	0.628	Von Willebrand factor C domain-containing protein 2-like
18	9606.ENSP00000354721	0.621	Sulfate anion transporter 1
19	9606.ENSP00000302562	0.619	HSPB1-associated protein 1
20	9606.ENSP00000252699	0.613	Alpha-actinin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030695	1.000	GTPase regulator activity
GO:0008047	1.000	enzyme activator activity
GO:0005096	0.949	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009966	0.992	regulation of signal transduction
GO:0009987	0.988	cellular process
GO:0051345	0.939	positive regulation of hydrolase activity
GO:0051056	0.929	regulation of small GTPase mediated signal transduction
GO:0051128	0.927	regulation of cellular component organization
GO:0050896	0.919	response to stimulus
GO:0043087	0.893	regulation of GTPase activity
GO:0048523	0.892	negative regulation of cellular process
GO:0007154	0.859	cell communication
GO:0023052	0.857	signaling
GO:0051716	0.850	cellular response to stimulus
GO:0043547	0.847	positive regulation of GTPase activity
GO:0046578	0.841	regulation of Ras protein signal transduction
GO:0010648	0.799	negative regulation of cell communication
GO:0009968	0.790	negative regulation of signal transduction
GO:0007165	0.756	signal transduction
GO:0051058	0.646	negative regulation of small GTPase mediated signal transduction
GO:0032502	0.585	developmental process
GO:0048856	0.568	anatomical structure development
GO:0071840	0.456	cellular component organization or biogenesis
GO:0016043	0.428	cellular component organization
GO:0046580	0.399	negative regulation of Ras protein signal transduction
GO:0044087	0.361	regulation of cellular component biogenesis
GO:0051129	0.346	negative regulation of cellular component organization
GO:0035556	0.337	intracellular signal transduction
GO:0007264	0.325	small GTPase mediated signal transduction
GO:0009653	0.314	anatomical structure morphogenesis
GO:0016477	0.304	cell migration
GO:0120035	0.302	regulation of plasma membrane bounded cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0070161	0.974	anchoring junction
GO:0005622	0.946	intracellular anatomical structure
GO:0005737	0.920	cytoplasm
GO:0030055	0.892	cell-substrate junction
GO:0016020	0.877	membrane
GO:0005925	0.871	focal adhesion
GO:0071944	0.839	cell periphery
GO:0043229	0.816	intracellular organelle
GO:0043227	0.805	membrane-bounded organelle
GO:0005829	0.794	cytosol
GO:0005886	0.788	plasma membrane
GO:0043231	0.781	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]