StarFunc result for job id Q8N271

User Input

>input (834 residues)
MKHTLALLAPLLGLGLGLALSQLAAGATDCKFLGPAEHLTFTPAARARWLAPRVRAPGLL
DSLYGTVRRFLSVVQLNPFPSELVKALLNELASVKVNEVVRYEAGYVVCAVIAGLYLLLV
PTAGLCFCCCRCHRRCGGRVKTEHKALACERAALMVFLLLTTLLLLIGVVCAFVTNQRTH
EQMGPSIEAMPETLLSLWGLVSDVPQELQAVAQQFSLPQEQVSEELDGVGVSIGSAIHTQ
LRSSVYPLLAAVGSLGQVLQVSVHHLQTLNATVVELQAGQQDLEPAIREHRDRLLELLQE
ARCQGDCAGALSWARTLELGADFSQVPSVDHVLHQLKGVPEANFSSMVQEENSTFNALPA
LAAMQTSSVVQELKKAVAQQPEGVRTLAEGFPGLEAASRWAQALQEVEESSRPYLQEVQR
YETYRWIVGCVLCSVVLFVVLCNLLGLNLGIWGLSARDDPSHPEAKGEAGARFLMAGVGL
SFLFAAPLILLVFATFLVGGNVQTLVCQSWENGELFEFADTPGNLPPSMNLSQLLGLRKN
ISIHQAYQQCKEGAALWTVLQLNDSYDLEEHLDINQYTNKLRQELQSLKVDTQSLDLLSS
AARRDLEALQSSGLQRIHYPDFLVQIQRPVVKTSMEQLAQELQGLAQAQDNSVLGQRLQE
EAQGLRNLHQEKVVPQQSLVAKLNLSVRALESSAPNLQLETSDVLANVTYLKGELPAWAA
RILRNVSECFLAREMGYFSQYVAWVREEVTQRIATCQPLSGALDNSRVILCDMMADPWNA
FWFCLAWCTFFLIPSIIFAVKTSKYFRPIRKRLSSTSSEETQLFHIPRVTSLKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N271	1.000	1.000	0.000	834	1.000	1.000	Q8N271.pdb.gz	PROM2_HUMAN Prominin-2 OS=Homo sapiens OX=9606 GN=PROM2 PE=1 SV=1
2	AFDB:Q8CJ52	0.868	0.868	6.063E-87	834	0.751	0.751	Q8CJ52.pdb.gz	PROM2_RAT Prominin-2 OS=Rattus norvegicus OX=10116 GN=Prom2 PE=1 SV=1
3	AFDB:Q3UUY6	0.929	0.928	2.318E-85	835	0.715	0.714	Q3UUY6.pdb.gz	PROM2_MOUSE Prominin-2 OS=Mus musculus OX=10090 GN=Prom2 PE=1 SV=1
4	AFDB:O54990	0.565	0.549	1.823E-42	867	0.261	0.251	O54990.pdb.gz	PROM1_MOUSE Prominin-1 OS=Mus musculus OX=10090 GN=Prom1 PE=1 SV=1
5	AFDB:F1RCM2	0.523	0.513	1.367E-41	853	0.271	0.265	F1RCM2.pdb.gz
6	AFDB:O43490	0.567	0.549	5.389E-41	865	0.253	0.244	O43490.pdb.gz	PROM1_HUMAN Prominin-1 OS=Homo sapiens OX=9606 GN=PROM1 PE=1 SV=1
7	AFDB:B7YZQ3	0.604	0.432	7.795E-25	1235	0.165	0.112	B7YZQ3.pdb.gz	B7YZQ3_DROME Prominin, isoform D OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
8	AFDB:P82295	0.558	0.470	1.860E-23	1013	0.179	0.147	P82295.pdb.gz	PROML_DROME Prominin-like protein OS=Drosophila melanogaster OX=7227 GN=promL PE=1 SV=1
9	AFDB:Q56ZN6	0.056	0.057	7.392E-5	802	0.096	0.100	Q56ZN6.pdb.gz	AVP2_ARATH Pyrophosphate-energized membrane proton pump 2 OS=Arabidopsis thaliana OX=3702 GN=AVPL1 PE=1 SV=2
10	AFDB:Q1PF01	0.162	0.223	2.352E-4	545	0.104	0.160	Q1PF01.pdb.gz	Q1PF01_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At2g25270 PE=1 SV=1
11	PDB:5lzqA	0.069	0.076	3.632E-4	725	0.124	0.142	5lzqA.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
12	PDB:7p5cA	0.100	0.195	3.957E-4	392	0.071	0.151	7p5cA.pdb.gz
13	PDB:5lzrB	0.072	0.084	9.736E-4	697	0.091	0.109	5lzrB.pdb.gz	Membrane pyrophosphatases from Thermotoga maritima and Vigna radiata suggest a conserved coupling mechanism.
14	PDB:5ykeB	0.074	0.073	1.107E-3	845	0.095	0.093	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
15	PDB:7p54A	0.099	0.174	1.156E-3	397	0.084	0.176	7p54A.pdb.gz
16	PDB:7p5jA	0.099	0.179	1.700E-3	399	0.079	0.165	7p5jA.pdb.gz
17	PDB:6x15A	0.067	0.105	3.098E-3	419	0.086	0.172	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
18	PDB:4av6A	0.081	0.097	8.304E-3	655	0.084	0.107	4av6A.pdb.gz	The Structure and Catalytic Cycle of a Sodium-Pumping Pyrophosphatase.
19	PDB:7vluA	0.065	0.050	2.323E-2	1159	0.115	0.083	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
20	PDB:6jpfA	0.060	0.078	2.642E-2	610	0.085	0.116	6jpfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UUY6	0.0	1179	835	0.717	0.716	PROM2_MOUSE Prominin-2 OS=Mus musculus OX=10090 GN=Prom2 PE=1 SV=1
2	Q8CJ52	0.0	1205	834	0.751	0.751	PROM2_RAT Prominin-2 OS=Rattus norvegicus OX=10116 GN=Prom2 PE=1 SV=1
3	Q8N271	0.0	1694	834	1.000	1.000	PROM2_HUMAN Prominin-2 OS=Homo sapiens OX=9606 GN=PROM2 PE=1 SV=1
4	Q90WI3	2.15e-122	391	851	0.275	0.269	Q90WI3_DANRE Prominin 1 b OS=Danio rerio OX=7955 GN=proml2 PE=2 SV=1
5	O54990	8.88e-115	371	867	0.258	0.248	PROM1_MOUSE Prominin-1 OS=Mus musculus OX=10090 GN=Prom1 PE=1 SV=1
6	O43490	8.88e-106	347	865	0.246	0.237	PROM1_HUMAN Prominin-1 OS=Homo sapiens OX=9606 GN=PROM1 PE=1 SV=1
7	Q06PM6	6.78e-21	100	910	0.203	0.186	Q06PM6_DROME Prominin OS=Drosophila melanogaster OX=7227 GN=prom PE=2 SV=1
8	Q8MLN9	1.36e-20	100	911	0.197	0.180	Q8MLN9_DROME Prominin, isoform C OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=2
9	A0AVW1	3.15e-20	99.0	1066	0.205	0.160	A0AVW1_DROME IP13255p OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
10	A0A0B4LGM0	1.54e-19	96.7	1173	0.205	0.146	A0A0B4LGM0_DROME Prominin, isoform E OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
11	B7YZQ3	2.93e-19	95.9	1235	0.205	0.138	B7YZQ3_DROME Prominin, isoform D OS=Drosophila melanogaster OX=7227 GN=prom PE=1 SV=1
12	P82295	2.91e-06	53.5	1013	0.074	0.061	PROML_DROME Prominin-like protein OS=Drosophila melanogaster OX=7227 GN=promL PE=1 SV=1
13	G5EBF5	0.20	37.4	385	0.025	0.055	G5EBF5_CAEEL DRBM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rde-4 PE=1 SV=1
14	Q1PF01	2.2	34.3	545	0.042	0.064	Q1PF01_ARATH Transmembrane protein OS=Arabidopsis thaliana OX=3702 GN=At2g25270 PE=1 SV=1
15	P15924	2.3	34.3	2871	0.040	0.011	DESP_HUMAN Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3
16	G3XCJ9	7.1	32.3	405	0.016	0.032	G3XCJ9_PSEAI Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Pseudomonas aeruginosa OX=287 GN=phzC PE=1 SV=1
17	Q7DC82	7.1	32.3	405	0.016	0.032	Q7DC82_PSEAE Phospho-2-dehydro-3-deoxyheptonate aldolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=phzC1 PE=3 SV=1
18	P39952	7.2	32.3	402	0.019	0.040	OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OXA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09972 DUF2207	2e+02	12.1	Predicted membrane protein (DUF2207)
2	PF19744 DUF6232	5.1e+02	12.5	Family of unknown function (DUF6232)
3	PF07264 EI24	4.2e+02	12.6	Etoposide-induced protein 2.4 (EI24)
4	PF15388 FAM117	2.5e+02	12.5	Protein Family FAM117
5	PF05478 Prominin	2.8e-294	989.9	Prominin
6	PF12390 Se-cys_synth_N	22	16.7	Selenocysteine synthase N terminal
7	PF18895 T4SS_pilin	5.2e+02	12.1	Type IV secretion system pilin
8	PF04906 Tweety	17	15.6	Tweety

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318270

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369291	0.708	LETM1 domain-containing protein LETM2, mitochondrial
2	9606.ENSP00000381053	0.654	Zinc finger MYND domain-containing protein 11
3	9606.ENSP00000402033	0.637	PDZ domain containing 2
4	9606.ENSP00000368710	0.584	Ras association domain-containing protein 2
5	9606.ENSP00000358374	0.522	Protein SCAF11
6	9606.ENSP00000242505	0.516	Protein FAM149B1
7	9606.ENSP00000370013	0.516	Pentatricopeptide repeat-containing protein 2, mitochondrial
8	9606.ENSP00000477141	0.514	DOMON domain-containing protein FRRS1L
9	9606.ENSP00000444743	0.510	Protein phosphatase Slingshot homolog 2
10	9606.ENSP00000306900	0.508	Prion-like protein doppel
11	9606.ENSP00000339256	0.502	NIPA-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0097159	0.332	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0019222	0.982	regulation of metabolic process
GO:0048522	0.969	positive regulation of cellular process
GO:0060255	0.966	regulation of macromolecule metabolic process
GO:0051171	0.963	regulation of nitrogen compound metabolic process
GO:0080090	0.962	regulation of primary metabolic process
GO:0031323	0.962	regulation of cellular metabolic process
GO:0048519	0.955	negative regulation of biological process
GO:0009893	0.939	positive regulation of metabolic process
GO:0010604	0.912	positive regulation of macromolecule metabolic process
GO:0048523	0.899	negative regulation of cellular process
GO:0009987	0.846	cellular process
GO:0051128	0.823	regulation of cellular component organization
GO:0051174	0.767	regulation of phosphorus metabolic process
GO:0051173	0.765	positive regulation of nitrogen compound metabolic process
GO:0019220	0.715	regulation of phosphate metabolic process
GO:0065009	0.712	regulation of molecular function
GO:0032879	0.687	regulation of localization
GO:0031325	0.685	positive regulation of cellular metabolic process
GO:0050790	0.668	regulation of catalytic activity
GO:0031399	0.666	regulation of protein modification process
GO:0060627	0.663	regulation of vesicle-mediated transport
GO:0051247	0.606	positive regulation of protein metabolic process
GO:0051336	0.597	regulation of hydrolase activity
GO:0043087	0.579	regulation of GTPase activity
GO:0030100	0.577	regulation of endocytosis
GO:0042325	0.534	regulation of phosphorylation
GO:0010562	0.533	positive regulation of phosphorus metabolic process
GO:0031401	0.345	positive regulation of protein modification process
GO:0001932	0.330	regulation of protein phosphorylation
GO:0001934	0.324	positive regulation of protein phosphorylation
GO:0051051	0.320	negative regulation of transport
GO:0051130	0.317	positive regulation of cellular component organization
GO:0051129	0.317	negative regulation of cellular component organization
GO:0045806	0.310	negative regulation of endocytosis
GO:0031344	0.302	regulation of cell projection organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1903561	0.999	extracellular vesicle
GO:0005615	0.956	extracellular space
GO:0016020	0.945	membrane
GO:0005886	0.938	plasma membrane
GO:0070062	0.923	extracellular exosome
GO:0005622	0.809	intracellular anatomical structure
GO:0043229	0.738	intracellular organelle
GO:0043231	0.730	intracellular membrane-bounded organelle
GO:0042995	0.608	cell projection
GO:0009986	0.567	cell surface
GO:0005737	0.446	cytoplasm
GO:0043233	0.354	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]