StarFunc result for job id Q8N283

User Input

>input (1001 residues)
MKRIFSCSSTQVAVERWNRHDQKLLEAVHRGDVGRVAALASRKSARPTKLDSNGQSPFHL
AASKGLTECLTILLANGADINSKNEDGSTALHLATISCQPQCVKVLLQHGANEDAVDAEN
RSPLHWAASSGCASSVLLLCDHEAFLDVLDNDGRTPLMIASLGGHAAICSQLLQRGARVN
VTDKNDKSALILACEKGSAEVAELLLSHGADAGAVDSTGHDALHYALHTQDKALWRHLQQ
ALSRRRRGGQRLVQHPDLASQASPSEPQAGSPPKSSWRAEPEEEQEEKEDEDPCSEEWRW
KYEEERRKVVRLEQELVQKTEECKTQAAAYLDLENQIREQAQELGVLLSWEPRASGKQGS
SLRPGGDGMEQGCPKDLLAESTQELKKQQQAAATVNPVLAPKKAEDSAPGKIQYEVHGRS
QPEEQGPPQSPASETIRKATGQQLTTNGAQTFGPDHADQLPAGQKESSQVLGVEPGGTVA
EPVGPAAMNQLLLQLREELAAVWREKDAARGALSRPVMEGALGTPRAEAAAAAWEKMEAR
LERVLARLEWAKAGLQVKPEVPSQESREGALKAAPGSIKQDEEKEKRVPGARGEPLGALG
GEKALGGLAKGQLEKEMSVLRLSNSNLLEELGELGRERQRLQRELQSLSQRLQREFVPKP
EAQVQLQQLRQSVGLLTNELAMEKEATEKLRKLLASQSSGLRGLWDCLPADLVGERSAQS
KAAESLEELRACISTLVDRHREAQQVLARLQEENQQLRGSLSPCREPGTSLKAPASPQVA
ALEQDLGKLEEELRAVQATMSGKSQEIGKLKQLLYQATEEVAELRAREAASLRQHEKTRG
SLVAQAQAWGQELKALLEKYNTACREVGRLREAVAEERRRSGDLAAQAAEQERQASEMRG
RSEQFEKTAELLKEKMEHLIGACRDKEAKIKELLKKLEQLSEEVLAIRGENARLALQLQD
SQKNHEEIISTYRNHLLNAARGYMEHEVYNILLQILSMEEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9P0K7	0.235	0.240	2.852E-30	980	0.236	0.241	Q9P0K7.pdb.gz	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
2	AFDB:Q9EP71	0.238	0.244	1.274E-29	979	0.249	0.254	Q9EP71.pdb.gz	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
3	AFDB:Q9BZF9	0.239	0.170	1.391E-25	1416	0.189	0.133	Q9BZF9.pdb.gz	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
4	AFDB:Q5TYW2	0.227	0.274	2.797E-19	823	0.170	0.207	Q5TYW2.pdb.gz	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
5	AFDB:Q9CZK6	0.184	0.278	1.815E-17	655	0.135	0.206	Q9CZK6.pdb.gz	ANKS3_MOUSE Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus OX=10090 GN=Anks3 PE=1 SV=2
6	AFDB:Q6ZW76	0.188	0.285	3.424E-17	656	0.143	0.218	Q6ZW76.pdb.gz	ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ANKS3 PE=1 SV=1
7	AFDB:Q69ZU8	0.196	0.263	1.076E-15	712	0.135	0.190	Q69ZU8.pdb.gz	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2
8	AFDB:Q9Y2G4	0.201	0.272	1.477E-15	727	0.133	0.183	Q9Y2G4.pdb.gz	ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3
9	AFDB:Q9DAM9	0.218	0.621	3.343E-15	344	0.068	0.198	Q9DAM9.pdb.gz	FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus OX=10090 GN=Fank1 PE=1 SV=1
10	AFDB:F1RBU2	0.202	0.271	5.261E-15	729	0.134	0.184	F1RBU2.pdb.gz
11	PDB:8cs9A	0.160	0.192	8.481E-13	796	0.074	0.093	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.214	0.891	5.963E-12	229	0.058	0.253	2dvwA.pdb.gz
13	PDB:4oauC	0.176	0.241	3.193E-11	692	0.073	0.105	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:1wg0A	0.206	0.805	3.534E-10	243	0.050	0.206	1wg0A.pdb.gz
15	PDB:5vkqA	0.180	0.125	5.820E-10	1499	0.072	0.048	5vkqA.pdb.gz
16	PDB:6v9hC	0.207	0.713	2.072E-9	270	0.071	0.263	6v9hC.pdb.gz
17	PDB:6aunA	0.163	0.243	2.400E-8	618	0.050	0.081	6aunA.pdb.gz
18	PDB:6jd6B	0.159	0.778	3.609E-8	192	0.048	0.250	6jd6B.pdb.gz
19	PDB:6mwqA	0.146	0.294	1.345E-7	493	0.057	0.116	6mwqA.pdb.gz
20	PDB:6pqpA	0.171	0.274	2.779E-7	615	0.051	0.083	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9EP71	4.73e-55	209	979	0.092	0.094	RAI14_MOUSE Ankycorbin OS=Mus musculus OX=10090 GN=Rai14 PE=1 SV=1
2	Q9P0K7	2.13e-53	204	980	0.091	0.093	RAI14_HUMAN Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2
3	H0YNH8	6.32e-51	198	1401	0.092	0.066	H0YNH8_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
4	Q8CGB3	3.35e-50	196	1411	0.093	0.066	UACA_MOUSE Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus OX=10090 GN=Uaca PE=1 SV=2
5	Q9BZF9	1.69e-49	194	1416	0.089	0.063	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
6	F5H2B9	2.48e-26	119	1307	0.055	0.042	F5H2B9_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
7	Q8TC84	2.62e-24	107	345	0.075	0.217	FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens OX=9606 GN=FANK1 PE=1 SV=3
8	Q17490	1.76e-23	110	6994	0.065	0.009	Q17490_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=2
9	G5ECZ1	2.74e-23	109	1867	0.067	0.036	G5ECZ1_CAEEL AO66 ankyrin OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
10	Q8MQG0	3.46e-23	109	1841	0.067	0.036	Q8MQG0_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-44 PE=1 SV=1
11	Q9DAM9	7.09e-23	103	344	0.065	0.189	FANK1_MOUSE Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus OX=10090 GN=Fank1 PE=1 SV=1
12	Q0KIE7	7.83e-23	108	1549	0.063	0.041	Q0KIE7_DROME Ankyrin, isoform B OS=Drosophila melanogaster OX=7227 GN=Ank PE=1 SV=1
13	Q24241	8.75e-23	107	1549	0.063	0.041	Q24241_DROME Ankyrin OS=Drosophila melanogaster OX=7227 GN=Ank PE=4 SV=1
14	O15084	1.34e-22	107	1053	0.075	0.071	ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens OX=9606 GN=ANKRD28 PE=1 SV=5
15	Q7KU92	3.30e-22	106	4083	0.064	0.016	Q7KU92_DROME Ankyrin 2, isoform L OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=2
16	Q7KU95	3.72e-22	106	2404	0.064	0.027	Q7KU95_DROME Ankyrin 2, isoform M OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
17	M9MS19	3.80e-22	106	4230	0.064	0.015	M9MS19_DROME Ankyrin 2, isoform P OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	M9MSK6	3.81e-22	106	4352	0.064	0.015	M9MSK6_DROME Ankyrin 2, isoform Q OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	A8JNM4	3.83e-22	106	2532	0.064	0.025	A8JNM4_DROME Ankyrin 2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	A8JNM6	3.99e-22	106	4189	0.064	0.015	A8JNM6_DROME Ankyrin 2, isoform J OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	5e-23	91.7	Ankyrin repeat
2	PF12796 Ank_2	1.5e-29	113.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	2.5e-18	75.1	Ankyrin repeat
4	PF13637 Ank_4	1.3e-21	87.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.3e-24	97.2	Ankyrin repeats (many copies)
6	PF08702 Fib_alpha	18	17.0	Fibrinogen alpha/beta chain family
7	PF02183 HALZ	57	15.3	Homeobox associated leucine zipper
8	PF05769 SIKE	56	15.1	SIKE family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347802

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354669	0.703	Ubiquitin carboxyl-terminal hydrolase MINDY-1
2	9606.ENSP00000358320	0.653	DNA-directed RNA polymerase III subunit RPC7-like
3	9606.ENSP00000462054	0.620	Zinc finger protein 92 homolog
4	9606.ENSP00000474487	0.610	LIX1-like protein
5	9606.ENSP00000351569	0.601	Small integral membrane protein 7
6	9606.ENSP00000334437	0.560	Nucleoside diphosphate-linked moiety X motif 17
7	9606.ENSP00000477509	0.556	Neuroblastoma breakpoint family member 11
8	9606.ENSP00000321962	0.521	Fin bud initiation factor homolog
9	9606.ENSP00000358312	0.508	Peroxisomal membrane protein 11B
10	9606.ENSP00000396747	0.502	Ankyrin repeat domain-containing protein 60

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0065007	0.742	biological regulation
GO:0050789	0.729	regulation of biological process
GO:0050794	0.680	regulation of cellular process
GO:0048518	0.367	positive regulation of biological process
GO:0008152	0.346	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005737	0.999	cytoplasm
GO:0043229	0.999	intracellular organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005829	0.967	cytosol
GO:0005634	0.854	nucleus
GO:0043228	0.781	non-membrane-bounded organelle
GO:0043232	0.736	intracellular non-membrane-bounded organelle
GO:0031974	0.637	membrane-enclosed lumen
GO:0043233	0.630	organelle lumen
GO:0070013	0.604	intracellular organelle lumen
GO:0016020	0.587	membrane
GO:0031981	0.499	nuclear lumen
GO:0005654	0.481	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]