StarFunc result for job id Q8N2C3

User Input

>input (294 residues)
MVPGEEPARELMAVLLTPRFRRLVSQNELPGPGLNGPSSRNRRDGFCRKRRTGCSGPFQA
TQLWDGIIHSLQAQVEIKRRRHHLQTYKDCFTGSDAVDVVLSHLMQNTCLSSNDISCLKG
VHLCQVLMNHKVFEPVGMKKLFKKEKELEFEDSNISLYRFLGNKSSYDCCKRQKDAENEF
NETLRPGYEMISNPLAQEIGEERIEELIHTINGNPALCPNITVQKPFLRLSKEDVWKEQT
LLCLLQLIHLPFLDNILEPPVKTQNLQLNKEEDLVITNTCLDRELIPSLCLPEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8WUY9	0.325	0.189	2.230E-7	529	0.187	0.104	Q8WUY9.pdb.gz	DEP1B_HUMAN DEP domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DEPDC1B PE=1 SV=2
2	AFDB:H2KZH5	0.279	0.139	5.065E-6	621	0.129	0.061	H2KZH5.pdb.gz	TOE2_CAEEL Target of ERK kinase mpk-1 OS=Caenorhabditis elegans OX=6239 GN=toe-2 PE=1 SV=1
3	AFDB:Q9UTR5	0.253	0.070	1.404E-5	1158	0.136	0.035	Q9UTR5.pdb.gz	RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf2 PE=1 SV=1
4	AFDB:B8JMI2	0.250	0.118	2.492E-5	676	0.122	0.053	B8JMI2.pdb.gz	B8JMI2_DANRE Dishevelled segment polarity protein 3a OS=Danio rerio OX=7955 GN=dvl3 PE=1 SV=1
5	AFDB:Q9Y7U6	0.284	0.075	5.707E-5	1334	0.122	0.027	Q9Y7U6.pdb.gz	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
6	AFDB:P51862	0.286	0.068	8.365E-5	1356	0.177	0.038	P51862.pdb.gz	ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ROM2 PE=1 SV=1
7	AFDB:Q18239	0.291	0.132	2.472E-4	759	0.129	0.050	Q18239.pdb.gz	Q18239_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-2 PE=1 SV=5
8	AFDB:Q21341	0.302	0.131	2.634E-4	698	0.136	0.057	Q21341.pdb.gz	LET99_CAEEL Protein let-99 OS=Caenorhabditis elegans OX=6239 GN=let-99 PE=1 SV=1
9	AFDB:H2KZ17	0.250	0.123	3.189E-4	702	0.153	0.064	H2KZ17.pdb.gz	H2KZ17_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
10	AFDB:D3ZB71	0.245	0.109	3.399E-4	736	0.129	0.052	D3ZB71.pdb.gz	D3ZB71_RAT Dishevelled segment polarity protein 2 OS=Rattus norvegicus OX=10116 GN=Dvl2 PE=3 SV=2
11	PDB:6pcvA	0.235	0.098	3.545E-4	754	0.082	0.032	6pcvA.pdb.gz
12	PDB:7pe9I	0.221	0.207	1.190E-3	317	0.095	0.088	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
13	PDB:4f7zA	0.230	0.078	1.535E-3	946	0.092	0.029	4f7zA.pdb.gz
14	PDB:2byvE	0.235	0.081	1.859E-3	922	0.092	0.029	2byvE.pdb.gz
15	PDB:7rx9A	0.236	0.166	4.256E-3	432	0.078	0.053	7rx9A.pdb.gz
16	PDB:7shfC	0.247	0.186	1.730E-2	400	0.122	0.090	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
17	PDB:7t3aA	0.188	0.062	1.030E-1	990	0.054	0.016	7t3aA.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
18	PDB:7jpsE	0.191	0.152	1.828E-1	386	0.051	0.039	7jpsE.pdb.gz	The dynamic nature of the human Origin Recognition Complex revealed through five cryoEM structures.
19	PDB:7vo0G	0.163	0.322	9.588E-1	131	0.065	0.145	7vo0G.pdb.gz	Structural basis of Streptomyces transcription activation by zinc uptake regulator.
20	PDB:4yrvA	0.170	0.173	1.701	288	0.082	0.083	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5TB30	4.39e-09	59.7	811	0.170	0.062	DEP1A_HUMAN DEP domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DEPDC1 PE=1 SV=2
2	Q8WUY9	2.70e-08	57.0	529	0.177	0.098	DEP1B_HUMAN DEP domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DEPDC1B PE=1 SV=2
3	Q69ZK0	6.97e-04	43.5	1650	0.136	0.024	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
4	A0A8I6GLR6	7.15e-04	43.5	1646	0.136	0.024	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
5	Q8TCU6	0.004	41.2	1659	0.129	0.023	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
6	F1R6J2	0.012	39.7	1622	0.129	0.023	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
7	Q9EQZ6	0.012	39.7	1011	0.088	0.026	RPGF4_MOUSE Rap guanine nucleotide exchange factor 4 OS=Mus musculus OX=10090 GN=Rapgef4 PE=1 SV=1
8	Q8WZA2	0.031	38.5	1011	0.088	0.026	RPGF4_HUMAN Rap guanine nucleotide exchange factor 4 OS=Homo sapiens OX=9606 GN=RAPGEF4 PE=1 SV=1
9	Q8TB45	0.037	37.7	409	0.078	0.056	DPTOR_HUMAN DEP domain-containing mTOR-interacting protein OS=Homo sapiens OX=9606 GN=DEPTOR PE=1 SV=2
10	Q21341	0.092	36.6	698	0.054	0.023	LET99_CAEEL Protein let-99 OS=Caenorhabditis elegans OX=6239 GN=let-99 PE=1 SV=1
11	O95398	0.10	36.6	923	0.082	0.026	RPGF3_HUMAN Rap guanine nucleotide exchange factor 3 OS=Homo sapiens OX=9606 GN=RAPGEF3 PE=1 SV=6
12	D3ZS72	0.12	36.6	1635	0.112	0.020	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
13	Q38DT0	0.13	34.3	112	0.078	0.205	Q38DT0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2270 PE=4 SV=1
14	Q9Z1C8	0.29	35.4	926	0.078	0.025	RPGF3_RAT Rap guanine nucleotide exchange factor 3 OS=Rattus norvegicus OX=10116 GN=Rapgef3 PE=2 SV=2
15	Q9WV52	0.31	34.7	353	0.085	0.071	PLEK2_MOUSE Pleckstrin-2 OS=Mus musculus OX=10090 GN=Plek2 PE=1 SV=1
16	O80902	0.79	33.5	431	0.068	0.046	CIPKM_ARATH CBL-interacting serine/threonine-protein kinase 22 OS=Arabidopsis thaliana OX=3702 GN=CIPK22 PE=1 SV=1
17	Q9LYQ8	1.2	33.1	456	0.061	0.039	CIPK2_ARATH CBL-interacting serine/threonine-protein kinase 2 OS=Arabidopsis thaliana OX=3702 GN=CIPK2 PE=1 SV=1
18	Q9SN43	1.3	33.1	489	0.061	0.037	CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana OX=3702 GN=CIPK12 PE=1 SV=1
19	Q9LZW4	1.7	32.7	442	0.065	0.043	CIPKE_ARATH CBL-interacting serine/threonine-protein kinase 14 OS=Arabidopsis thaliana OX=3702 GN=CIPK14 PE=1 SV=1
20	O22932	1.8	32.7	435	0.068	0.046	CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana OX=3702 GN=CIPK11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	1.1e-15	68.7	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF13746 Fer4_18	2.2e+02	13.5	4Fe-4S dicluster domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396234

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440703	0.681	Nuclear pore complex interacting protein family member B5
2	9606.ENSP00000383105	0.665	GATOR complex protein DEPDC5
3	9606.ENSP00000313110	0.653	Olfactory receptor 6S1
4	9606.ENSP00000331845	0.602	Protein PRR14L
5	9606.ENSP00000404439	0.600	Nuclear pore complex interacting protein family member B4
6	9606.ENSP00000450444	0.568	HEAT repeat-containing protein 4
7	9606.ENSP00000375820	0.567	Zinc finger protein 233
8	9606.ENSP00000467931	0.567	Zinc finger protein 461
9	9606.ENSP00000328444	0.561	Keratin-associated protein 4-8
10	9606.ENSP00000482749	0.556	Zinc finger protein 227
11	9606.ENSP00000360938	0.554	Sarcosine dehydrogenase, mitochondrial
12	9606.ENSP00000415070	0.517	ZNF559-ZNF177 readthrough
13	9606.ENSP00000279907	0.504	UHRF1-binding protein 1-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0007154	0.331	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043226	0.974	organelle
GO:0043229	0.961	intracellular organelle
GO:0043227	0.957	membrane-bounded organelle
GO:0043231	0.947	intracellular membrane-bounded organelle
GO:0005634	0.923	nucleus
GO:0005829	0.922	cytosol
GO:0070013	0.417	intracellular organelle lumen
GO:0031981	0.341	nuclear lumen
GO:0005654	0.332	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]