StarFunc result for job id Q8N2H3

User Input

>input (581 residues)
MAASGRGLCKAVAASPFPAWRRDNTEARGGLKPEYDAVVIGAGHNGLVAAAYLQRLGVNT
AVFERRHVIGGAAVTEEIIPGFKFSRASYLLSLLRPQIYTDLELKKHGLRLHLRNPYSFT
PMLEEGAGSKVPRCLLLGTDMAENQKQIAQFSQKDAQVFPKYEEFMHRLALAIDPLLDAA
PVDMAAFQHGSLLQRMRSLSTLKPLLKAGRILGAQLPRYYEVLTAPITKVLDQWFESEPL
KATLATDAVIGAMTSPHTPGSGYVLLHHVMGGLEGMQGAWGYVQGGMGALSDAIASSATT
HGASIFTEKTVAKVQVNSEGCVQGVVLEDGTEVRSKMVLSNTSPQITFLKLTPQEWLPEE
FLERISQLDTRSPVTKINVAVDRLPSFLAAPNAPRGQPLPHHQCSIHLNCEDTLLLHQAF
EDAMDGLPSHRPVIELCIPSSLDPTLAPPGCHVVSLFTQYMPYTLAGGKAWDEQERDAYA
DRVFDCIEVYAPGFKDSVVGRDILTPPDLERIFGLPGGNIFHCAMSLDQLYFARPVPLHS
GYRCPLQGLYLCGSGAHPGGGVMGAAGRNAAHVAFRDLKSM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2H3	1.000	1.000	0.000	581	1.000	1.000	Q8N2H3.pdb.gz	PYRD2_HUMAN Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PYROXD2 PE=1 SV=2
2	AFDB:F4K658	0.910	0.950	1.876E-75	556	0.503	0.525	F4K658.pdb.gz	F4K658_ARATH FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g49555 PE=1 SV=1
3	AFDB:O07794	0.766	0.827	1.496E-39	536	0.250	0.271	O07794.pdb.gz	O07794_MYCTU Probable dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3829c PE=4 SV=2
4	AFDB:P21685	0.728	0.852	1.337E-32	492	0.198	0.234	P21685.pdb.gz	CRTI_PANAN Phytoene desaturase (lycopene-forming) OS=Pantoea ananas OX=553 GN=crtI PE=1 SV=1
5	AFDB:Q9FVR9	0.685	0.692	2.485E-30	574	0.205	0.207	Q9FVR9.pdb.gz	Q9FVR9_ARATH FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g57770 PE=1 SV=1
6	AFDB:Q4W8B6	0.717	0.836	4.077E-30	493	0.212	0.249	Q4W8B6.pdb.gz	Q4W8B6_9CAUL Phytoene desaturase OS=Brevundimonas sp. NBRC 101024 OX=1113698 GN=crtI PE=3 SV=1
7	AFDB:Q8X0Z0	0.719	0.732	7.066E-30	570	0.191	0.195	Q8X0Z0.pdb.gz	CARB_GIBFU Phytoene desaturase OS=Gibberella fujikuroi OX=5127 GN=carB PE=1 SV=2
8	AFDB:Q9RW08	0.724	0.764	1.526E-29	548	0.212	0.224	Q9RW08.pdb.gz	Q9RW08_DEIRA Phytoene dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_0861 PE=3 SV=1
9	AFDB:P54979	0.717	0.799	1.800E-29	517	0.176	0.197	P54979.pdb.gz	CRTJ_MYXXA zeta-carotene-forming phytoene desaturase OS=Myxococcus xanthus OX=34 GN=carA2 PE=1 SV=1
10	AFDB:P17054	0.704	0.775	4.585E-29	524	0.201	0.223	P17054.pdb.gz	CRTI_RHOCB Phytoene desaturase (neurosporene-forming) OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) OX=272942 GN=crtI PE=1 SV=1
11	PDB:4dgkA	0.515	0.712	3.875E-21	405	0.165	0.237	4dgkA.pdb.gz
12	PDB:2bcgG	0.454	0.577	2.094E-15	442	0.093	0.122	2bcgG.pdb.gz	Structure of doubly prenylated Ypt1:GDI complex and the mechanism of GDI-mediated Rab recycling
13	PDB:2z5xA	0.528	0.587	2.229E-14	513	0.148	0.168	2z5xA.pdb.gz	Structure of human monoamine oxidase A at 2.2-A resolution: The control of opening the entry for substrates/inhibitors
14	PDB:1o5wC	0.536	0.597	2.629E-14	512	0.146	0.166	1o5wC.pdb.gz	Structure of rat monoamine oxidase a and its specific recognitions for substrates and inhibitors.
15	PDB:1lv0A	0.416	0.535	7.077E-14	433	0.095	0.127	1lv0A.pdb.gz	Geranylgeranyl switching regulates GDI-Rab GTPase recycling.
16	PDB:3nksA	0.467	0.568	1.040E-13	465	0.151	0.189	3nksA.pdb.gz	Structural insight into human variegate porphyria disease
17	PDB:5ts5A	0.457	0.539	4.592E-13	483	0.124	0.149	5ts5A.pdb.gz	Crystal structure and molecular dynamics studies of L-amino acid oxidase from Bothrops atrox.
18	PDB:6fvzA	0.544	0.617	5.415E-13	500	0.151	0.176	6fvzA.pdb.gz	Tight-Binding Inhibition of Human Monoamine Oxidase B by Chromone Analogs: A Kinetic, Crystallographic, and Biological Analysis.
19	PDB:1vg9C	0.445	0.505	1.379E-12	502	0.129	0.149	1vg9C.pdb.gz	Structure of the Rab7:REP-1 complex: insights into the mechanism of Rab prenylation and choroideremia disease
20	PDB:3kpfA	0.496	0.598	1.816E-12	467	0.143	0.178	3kpfA.pdb.gz	The crystal structure of the mutant K300M of polyamine oxidase from ZEA MAYS unveils the role of LYS300 in catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F4K658	0.0	560	556	0.506	0.529	F4K658_ARATH FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=At5g49555 PE=1 SV=1
2	Q8N2H3	0.0	1198	581	1.000	1.000	PYRD2_HUMAN Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PYROXD2 PE=1 SV=2
3	O07794	7.16e-40	154	536	0.277	0.300	O07794_MYCTU Probable dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3829c PE=4 SV=2
4	P21685	5.70e-15	80.1	492	0.220	0.260	CRTI_PANAN Phytoene desaturase (lycopene-forming) OS=Pantoea ananas OX=553 GN=crtI PE=1 SV=1
5	Q9M9Y8	2.43e-13	75.1	595	0.136	0.133	CRTSO_ARATH Prolycopene isomerase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CRTISO PE=1 SV=2
6	P17054	1.27e-12	72.8	524	0.127	0.141	CRTI_RHOCB Phytoene desaturase (neurosporene-forming) OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) OX=272942 GN=crtI PE=1 SV=1
7	Q4W8B6	1.18e-10	66.2	493	0.244	0.288	Q4W8B6_9CAUL Phytoene desaturase OS=Brevundimonas sp. NBRC 101024 OX=1113698 GN=crtI PE=3 SV=1
8	Q8X0Z0	8.95e-10	63.9	570	0.213	0.218	CARB_GIBFU Phytoene desaturase OS=Gibberella fujikuroi OX=5127 GN=carB PE=1 SV=2
9	Q9RW08	7.83e-09	60.8	548	0.155	0.164	Q9RW08_DEIRA Phytoene dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / CCUG 27074 / LMG 4051 / NBRC 15346 / NCIMB 9279 / VKM B-1422 / R1) OX=243230 GN=DR_0861 PE=3 SV=1
10	Q7WT72	3.63e-08	58.5	488	0.208	0.248	CRTDH_FLAS9 1-hydroxycarotenoid 3,4-desaturase OS=Flavobacterium sp. (strain P99-3) OX=216393 GN=crtD PE=1 SV=1
11	Q64FW2	1.95e-07	56.2	609	0.172	0.164	RETST_MOUSE All-trans-retinol 13,14-reductase OS=Mus musculus OX=10090 GN=Retsat PE=1 SV=3
12	Q9FVR9	3.30e-07	55.5	574	0.229	0.232	Q9FVR9_ARATH FAD/NAD(P)-binding oxidoreductase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g57770 PE=1 SV=1
13	A0A0A1GKA2	1.95e-05	49.7	495	0.193	0.226	CRTD_HALJT Carotenoid 3,4-desaturase OS=Haloarcula japonica (strain ATCC 49778 / DSM 6131 / JCM 7785 / NBRC 101032 / NCIMB 13157 / TR-1) OX=1227453 GN=crtD PE=1 SV=1
14	H8ZPX1	1.72e-04	46.6	497	0.059	0.068	PNAO_PSESP Pseudooxynicotine dehydrogenase OS=Pseudomonas sp. OX=306 GN=pao PE=1 SV=1
15	Q02861	1.97e-04	46.6	529	0.124	0.136	CRTI_MYXXA All-trans-zeta-carotene desaturase OS=Myxococcus xanthus OX=34 GN=carC PE=1 SV=1
16	Q02733	0.007	41.6	499	0.040	0.046	IRC15_YEAST Increased recombination centers protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRC15 PE=1 SV=1
17	P9WHH5	0.016	40.4	468	0.043	0.053	STHA_MYCTU Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sthA PE=1 SV=1
18	P09624	0.021	40.0	499	0.046	0.054	DLDH_YEAST Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LPD1 PE=1 SV=1
19	Q5LRA7	0.021	40.0	464	0.041	0.052	Q5LRA7_RUEPO Dihydrolipoyl dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=SPO2222 PE=3 SV=1
20	Q21988	0.023	40.0	824	0.072	0.051	KDM1B_CAEEL Lysine-specific histone demethylase 1B homolog OS=Caenorhabditis elegans OX=6239 GN=amx-1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01262 AlaDh_PNT_C	47	14.7	Alanine dehydrogenase/PNT, C-terminal domain
2	PF01593 Amino_oxidase	1.7e-09	49.2	Flavin containing amine oxidoreductase
3	PF02017 CIDE-N	7.2e+02	11.6	CIDE-N domain
4	PF01266 DAO	7.1e-05	34.2	FAD dependent oxidoreductase
5	PF00890 FAD_binding_2	0.99	20.1	FAD binding domain
6	PF01494 FAD_binding_3	5.6	17.7	FAD binding domain
7	PF12831 FAD_oxidored	0.14	23.1	FAD dependent oxidoreductase
8	PF01134 GIDA	0.3	21.8	Glucose inhibited division protein A
9	PF03486 HI0933_like	2.6e+02	11.7	HI0933-like protein
10	PF05834 Lycopene_cycl	8.8e+02	10.3	Lycopene cyclase protein
11	PF13450 NAD_binding_8	1.1e-06	40.1	NAD(P)-binding Rossmann-like domain
12	PF00070 Pyr_redox	0.012	27.4	Pyridine nucleotide-disulphide oxidoreductase
13	PF07992 Pyr_redox_2	0.0097	26.8	Pyridine nucleotide-disulphide oxidoreductase
14	PF01946 Thi4	0.21	22.4	Thi4 family
15	PF04820 Trp_halogenase	73	13.7	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309175	0.744	Probable RNA-binding protein EIF1AD
2	9606.ENSP00000240651	0.736	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1
3	9606.ENSP00000368140	0.719	Cardiolipin synthase (CMP-forming)
4	9606.ENSP00000357804	0.717	Acyl-coenzyme A thioesterase THEM4
5	9606.ENSP00000254928	0.708	GTPase Era, mitochondrial
6	9606.ENSP00000319255	0.706	Cysteine and histidine-rich domain-containing protein 1
7	9606.ENSP00000359518	0.705	MRG/MORF4L-binding protein
8	9606.ENSP00000357440	0.701	Heat shock factor protein 2
9	9606.ENSP00000398596	0.690	Phosphatidate cytidylyltransferase, mitochondrial
10	9606.ENSP00000083182	0.670	Amyloid protein-binding protein 2
11	9606.ENSP00000397459	0.669	Dual specificity protein phosphatase 22
12	9606.ENSP00000323047	0.635	Mitochondrial ribosome-associated GTPase 1
13	9606.ENSP00000272425	0.612	N-acetyltransferase 8
14	9606.ENSP00000263063	0.600	Poly(A) RNA polymerase, mitochondrial
15	9606.ENSP00000334375	0.592	Leucine rich repeats and calponin homology domain containing 3
16	9606.ENSP00000416125	0.592	Rho guanine nucleotide exchange factor 38
17	9606.ENSP00000353739	0.574	protein-L-isoaspartate O-methyltransferase domain containing 1
18	9606.ENSP00000377357	0.573	Palmitoyltransferase ZDHHC16
19	9606.ENSP00000366430	0.569	Protein LZIC
20	9606.ENSP00000480828	0.553	Squalene synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003824	0.897	catalytic activity
GO:0016491	0.700	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007005	0.979	mitochondrion organization
GO:0008152	0.508	metabolic process
GO:0071704	0.490	organic substance metabolic process
GO:0044237	0.413	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.993	intracellular organelle lumen
GO:0005759	0.863	mitochondrial matrix
GO:0031981	0.357	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.700	Oxidoreductases.

[back to server]