StarFunc result for job id Q8N2H9

User Input

>input (469 residues)
MVLEGNPEVGSPRTSDLQHRGNKGSCVLSSPGEDAQPGEEPIKYGELIVLGCCEEGGEET
EAQRGEVTGPRAHSCYNGCLASGDKGRRRSRLALSRRSHANGVKPDVMHHISTPLVSKAL
SNRGQHSISYTLSRSHSVIVEYTHDSDTDMFQIGRSTENMIDFVVTDTSPGGGAAEGPSA
QSTISRYACRILCDRRPPYTARIYAAGFDASSNIFLGERAAKWRTPDGLMDGLTTNGVLV
MHPAGGFSEDSAPGVWREISVCGNVYTLRDSRSAQQRGKLVENESNVLQDGSLIDLCGAT
LLWRTPAGLLRAPTLKQLEAQRQEANAARPQCPVGLSTLAFPSPARGRTAPDKQQPWVYV
RCGHVHGYHGWGCRRERGPQERECPLCRLVGPYVPLWLGQEAGLCLDPGPPSHAFAPCGH
VCSEKTARYWAQTPLPHGTHAFHAACPFCGAWLTGEHGCVRLIFQGPLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2H9	1.000	1.000	1.896E-99	469	1.000	1.000	Q8N2H9.pdb.gz	PELI3_HUMAN E3 ubiquitin-protein ligase pellino homolog 3 OS=Homo sapiens OX=9606 GN=PELI3 PE=1 SV=2
2	AFDB:A4QN36	0.850	0.935	7.024E-72	425	0.625	0.689	A4QN36.pdb.gz	A4QN36_DANRE Pellino E3 ubiquitin protein ligase 1b OS=Danio rerio OX=7955 GN=zgc:153297 PE=2 SV=1
3	AFDB:Q9HAT8	0.858	0.957	1.078E-70	420	0.635	0.710	Q9HAT8.pdb.gz	PELI2_HUMAN E3 ubiquitin-protein ligase pellino homolog 2 OS=Homo sapiens OX=9606 GN=PELI2 PE=1 SV=1
4	AFDB:O77237	0.833	0.920	9.398E-60	424	0.471	0.521	O77237.pdb.gz	PELI_DROME Protein pellino OS=Drosophila melanogaster OX=7227 GN=Pli PE=1 SV=1
5	AFDB:Q6PIK7	0.148	0.101	8.435E-3	714	0.070	0.046	Q6PIK7.pdb.gz	Q6PIK7_HUMAN Angiogenic factor with G patch and FHA domains 1 OS=Homo sapiens OX=9606 GN=AGGF1 PE=1 SV=1
6	AFDB:Q9Z7J3	0.144	0.084	1.741E-2	845	0.107	0.059	Q9Z7J3.pdb.gz	Q9Z7J3_CHLPN Adenylate cyclase-like protein OS=Chlamydia pneumoniae OX=83558 GN=CP_0034 PE=1 SV=1
7	AFDB:A1EAT1	0.142	0.130	4.246E-2	522	0.070	0.063	A1EAT1.pdb.gz	A1EAT1_CHICK Checkpoint and tumor suppressor protein 2 OS=Gallus gallus OX=9031 GN=CHEK2 PE=1 SV=1
8	AFDB:F1RD88	0.156	0.098	4.246E-2	775	0.075	0.045	F1RD88.pdb.gz
9	AFDB:O60333	0.136	0.039	5.307E-2	1816	0.041	0.010	O60333.pdb.gz	KIF1B_HUMAN Kinesin-like protein KIF1B OS=Homo sapiens OX=9606 GN=KIF1B PE=1 SV=5
10	AFDB:O96017	0.138	0.121	5.307E-2	543	0.070	0.061	O96017.pdb.gz	CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=1
11	PDB:2kb3A	0.120	0.356	8.302E-2	143	0.036	0.119	2kb3A.pdb.gz
12	PDB:2ff4A	0.126	0.153	1.713E-1	379	0.047	0.058	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
13	PDB:6l9wD	0.128	0.356	1.812E-1	142	0.036	0.120	6l9wD.pdb.gz
14	PDB:7kzmD	0.069	0.070	2.991E-1	456	0.034	0.035	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.
15	PDB:7d5sB2	0.054	0.037	4.940E-1	851	0.036	0.020	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:2jz4A	0.092	0.117	5.522E-1	299	0.079	0.124	2jz4A.pdb.gz
17	PDB:6qk7A	0.076	0.049	5.522E-1	1161	0.062	0.025	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
18	PDB:3gfcA	0.062	0.077	7.715E-1	339	0.019	0.027	3gfcA.pdb.gz
19	PDB:4j1xC	0.077	0.133	9.119E-1	195	0.021	0.051	4j1xC.pdb.gz	Mechanistic studies of an unprecedented enzyme-catalysed 1,2-phosphono-migration reaction.
20	PDB:7eu1A	0.066	0.036	1.019	1065	0.062	0.027	7eu1A.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4QN36	0.0	597	425	0.620	0.685	A4QN36_DANRE Pellino E3 ubiquitin protein ligase 1b OS=Danio rerio OX=7955 GN=zgc:153297 PE=2 SV=1
2	Q8BST6	0.0	626	419	0.633	0.709	PELI2_MOUSE E3 ubiquitin-protein ligase pellino homolog 2 OS=Mus musculus OX=10090 GN=Peli2 PE=1 SV=2
3	Q8BXR6	0.0	874	445	0.919	0.969	PELI3_MOUSE E3 ubiquitin-protein ligase pellino homolog 3 OS=Mus musculus OX=10090 GN=Peli3 PE=1 SV=2
4	Q8C669	0.0	617	418	0.627	0.703	PELI1_MOUSE E3 ubiquitin-protein ligase pellino homolog 1 OS=Mus musculus OX=10090 GN=Peli1 PE=1 SV=2
5	Q8N2H9	0.0	964	469	1.000	1.000	PELI3_HUMAN E3 ubiquitin-protein ligase pellino homolog 3 OS=Homo sapiens OX=9606 GN=PELI3 PE=1 SV=2
6	Q96FA3	0.0	618	418	0.627	0.703	PELI1_HUMAN E3 ubiquitin-protein ligase pellino homolog 1 OS=Homo sapiens OX=9606 GN=PELI1 PE=1 SV=2
7	Q9HAT8	0.0	620	420	0.635	0.710	PELI2_HUMAN E3 ubiquitin-protein ligase pellino homolog 2 OS=Homo sapiens OX=9606 GN=PELI2 PE=1 SV=1
8	O77237	2.39e-147	429	424	0.473	0.524	PELI_DROME Protein pellino OS=Drosophila melanogaster OX=7227 GN=Pli PE=1 SV=1
9	O94711	0.38	35.8	720	0.034	0.022	GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gyp2 PE=3 SV=1
10	Q5TG30	2.8	33.1	622	0.051	0.039	RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens OX=9606 GN=ARHGAP40 PE=3 SV=3
11	Q4KLN6	3.5	32.3	390	0.087	0.105	RIR2_RAT Ribonucleoside-diphosphate reductase subunit M2 OS=Rattus norvegicus OX=10116 GN=Rrm2 PE=2 SV=1
12	Q948J9	6.2	31.6	278	0.055	0.094	LIP2P_ARATH Octanoyltransferase LIP2p, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LIP2P PE=1 SV=1
13	Q9UJJ9	8.8	31.2	305	0.060	0.092	GNPTG_HUMAN N-acetylglucosamine-1-phosphotransferase subunit gamma OS=Homo sapiens OX=9606 GN=GNPTG PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04710 Pellino	1.8e-199	674.2	Pellino
2	PF13920 zf-C3HC4_3	3.7	18.8	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358997	0.981	Interleukin-1 receptor-associated kinase 1
2	9606.ENSP00000433623	0.956	TNF receptor-associated factor 6
3	9606.ENSP00000358335	0.841	Mitogen-activated protein kinase kinase kinase 7
4	9606.ENSP00000390651	0.829	Interleukin-1 receptor-associated kinase 4
5	9606.ENSP00000316176	0.760	Ubiquitin-conjugating enzyme E2 N
6	9606.ENSP00000340305	0.747	Ubiquitin-conjugating enzyme E2 variant 1
7	9606.ENSP00000483825	0.717	NF-kappa-B essential modulator
8	9606.ENSP00000430684	0.710	Inhibitor of nuclear factor kappa-B kinase subunit beta
9	9606.ENSP00000359424	0.694	Inhibitor of nuclear factor kappa-B kinase subunit alpha
10	9606.ENSP00000380116	0.651	Proline and serine rich 3
11	9606.ENSP00000482657	0.648	Mitogen-activated protein kinase kinase kinase 14
12	9606.ENSP00000442291	0.625	IQ motif containing C
13	9606.ENSP00000338788	0.550	Zinc finger CCCH domain-containing protein 15
14	9606.ENSP00000356070	0.540	MAP kinase-activated protein kinase 2
15	9606.ENSP00000354501	0.529	Zinc finger protein 277
16	9606.ENSP00000401399	0.505	Myeloid differentiation primary response protein MyD88
17	9606.ENSP00000199814	0.502	Pre-mRNA-splicing factor RBM22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016740	0.999	transferase activity
GO:0140096	0.996	catalytic activity, acting on a protein
GO:0004842	0.988	ubiquitin-protein transferase activity
GO:0061630	0.596	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0043067	0.993	regulation of programmed cell death
GO:0048523	0.991	negative regulation of cellular process
GO:0060761	0.986	negative regulation of response to cytokine stimulus
GO:0001959	0.986	regulation of cytokine-mediated signaling pathway
GO:0009968	0.980	negative regulation of signal transduction
GO:0010803	0.976	regulation of tumor necrosis factor-mediated signaling pathway
GO:2001236	0.976	regulation of extrinsic apoptotic signaling pathway
GO:0048518	0.971	positive regulation of biological process
GO:0019222	0.935	regulation of metabolic process
GO:0001960	0.935	negative regulation of cytokine-mediated signaling pathway
GO:2001237	0.934	negative regulation of extrinsic apoptotic signaling pathway
GO:0060255	0.933	regulation of macromolecule metabolic process
GO:0048522	0.933	positive regulation of cellular process
GO:0050896	0.920	response to stimulus
GO:0043170	0.838	macromolecule metabolic process
GO:0051171	0.837	regulation of nitrogen compound metabolic process
GO:0006807	0.833	nitrogen compound metabolic process
GO:0080090	0.829	regulation of primary metabolic process
GO:0048584	0.818	positive regulation of response to stimulus
GO:0036211	0.817	protein modification process
GO:0009967	0.807	positive regulation of signal transduction
GO:0010468	0.792	regulation of gene expression
GO:0031323	0.700	regulation of cellular metabolic process
GO:0009987	0.644	cellular process
GO:0009607	0.638	response to biotic stimulus
GO:0044419	0.626	biological process involved in interspecies interaction between organisms
GO:0010604	0.612	positive regulation of macromolecule metabolic process
GO:0006950	0.609	response to stress
GO:0016567	0.596	protein ubiquitination
GO:0000209	0.580	protein polyubiquitination
GO:0051707	0.575	response to other organism
GO:0045088	0.545	regulation of innate immune response
GO:0050778	0.518	positive regulation of immune response
GO:0001817	0.517	regulation of cytokine production
GO:0031349	0.493	positive regulation of defense response
GO:1902531	0.491	regulation of intracellular signal transduction
GO:0042221	0.468	response to chemical
GO:0043122	0.461	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0032103	0.459	positive regulation of response to external stimulus
GO:0031399	0.444	regulation of protein modification process
GO:0010033	0.429	response to organic substance
GO:0002833	0.428	positive regulation of response to biotic stimulus
GO:0045089	0.401	positive regulation of innate immune response
GO:0009892	0.398	negative regulation of metabolic process
GO:0009889	0.397	regulation of biosynthetic process
GO:0043123	0.396	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0031326	0.391	regulation of cellular biosynthetic process
GO:0051252	0.380	regulation of RNA metabolic process
GO:0051173	0.353	positive regulation of nitrogen compound metabolic process
GO:0006952	0.342	defense response
GO:0006355	0.341	regulation of DNA-templated transcription
GO:0051090	0.327	regulation of DNA-binding transcription factor activity
GO:0010605	0.304	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.806	intracellular membrane-bounded organelle
GO:0016020	0.784	membrane
GO:0005634	0.758	nucleus
GO:0071944	0.700	cell periphery
GO:0005886	0.682	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]