StarFunc result for job id Q8N2K0

User Input

>input (398 residues)
MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKR
ALGRRKGVWLRLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQ
GLNHTCNYYLQPEEDVTIGVWHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGT
RGGDHRVELYKVLSSLGYHVVTFDYRGWGDSVGTPSERGMTYDALHVFDWIKARSGDNPV
YIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIREEAKSHPFSVIYRYFPGFDWF
FLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQ
FVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2K0	1.000	1.000	1.030E-77	398	1.000	1.000	Q8N2K0.pdb.gz	ABD12_HUMAN Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12 PE=1 SV=2
2	AFDB:Q08C93	0.839	0.873	9.721E-59	382	0.656	0.683	Q08C93.pdb.gz	ABD12_DANRE Lysophosphatidylserine lipase ABHD12 OS=Danio rerio OX=7955 GN=abhd12 PE=2 SV=1
3	AFDB:Q7Z5M8	0.717	0.787	3.711E-40	362	0.389	0.428	Q7Z5M8.pdb.gz	AB12B_HUMAN Protein ABHD12B OS=Homo sapiens OX=9606 GN=ABHD12B PE=1 SV=1
4	AFDB:Q8RXP6	0.577	0.731	1.703E-17	308	0.186	0.240	Q8RXP6.pdb.gz	WAV2_ARATH Alpha/beta hydrolase domain-containing protein WAV2 OS=Arabidopsis thaliana OX=3702 GN=WAV2 PE=2 SV=1
5	AFDB:Q8VYP9	0.449	0.386	8.923E-13	476	0.153	0.128	Q8VYP9.pdb.gz	ICML1_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 OS=Arabidopsis thaliana OX=3702 GN=ICMEL1 PE=2 SV=1
6	PDB:6eicB	0.449	0.622	1.071E-12	279	0.133	0.190	6eicB.pdb.gz
7	AFDB:Q1PET6	0.469	0.444	1.971E-12	422	0.146	0.137	Q1PET6.pdb.gz	ICML2_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2 OS=Arabidopsis thaliana OX=3702 GN=ICMEL2 PE=2 SV=1
8	AFDB:Q94AS5	0.439	0.413	2.085E-12	427	0.141	0.131	Q94AS5.pdb.gz	ICME_ARATH Isoprenylcysteine alpha-carbonyl methylesterase ICME OS=Arabidopsis thaliana OX=3702 GN=ICME PE=1 SV=1
9	AFDB:Q4GYA0	0.508	0.317	8.583E-12	670	0.143	0.085	Q4GYA0.pdb.gz	Q4GYA0_TRYB2 Serine peptidase, putative serine peptidase, Clan SC, Family S9D OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4780 PE=4 SV=1
10	PDB:7prmA	0.451	0.593	1.221E-11	295	0.118	0.159	7prmA.pdb.gz	Development of High Brain-Penetrant and Reversible Monoacylglycerol Lipase PET Tracers for Neuroimaging.
11	AFDB:F4JKY3	0.423	0.537	2.247E-11	304	0.138	0.181	F4JKY3.pdb.gz	F4JKY3_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g15955 PE=1 SV=1
12	PDB:2ocgA	0.422	0.636	7.058E-11	254	0.123	0.193	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
13	PDB:4zwnB	0.454	0.566	9.911E-11	311	0.141	0.180	4zwnB.pdb.gz
14	PDB:5jzsB	0.402	0.539	4.568E-10	284	0.123	0.173	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
15	PDB:3e3aB	0.420	0.586	9.010E-10	275	0.111	0.160	3e3aB.pdb.gz
16	AFDB:P77044	0.395	0.525	9.961E-10	288	0.103	0.142	P77044.pdb.gz	MHPC_ECOLI 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mhpC PE=1 SV=4
17	PDB:1q0rA	0.382	0.497	1.130E-9	297	0.108	0.145	1q0rA.pdb.gz	Crystal structure of aclacinomycin methylesterase with bound product analogues: implications for anthracycline recognition and mechanism.
18	PDB:5xb6A	0.430	0.542	1.265E-9	306	0.103	0.134	5xb6A.pdb.gz
19	PDB:6y0fC	0.413	0.247	1.679E-9	722	0.116	0.064	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
20	PDB:4kryE	0.432	0.510	1.777E-9	329	0.113	0.137	4kryE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q08C93	0.0	537	382	0.656	0.683	ABD12_DANRE Lysophosphatidylserine lipase ABHD12 OS=Danio rerio OX=7955 GN=abhd12 PE=2 SV=1
2	Q8N2K0	0.0	827	398	1.000	1.000	ABD12_HUMAN Lysophosphatidylserine lipase ABHD12 OS=Homo sapiens OX=9606 GN=ABHD12 PE=1 SV=2
3	Q99LR1	0.0	756	398	0.932	0.932	ABD12_MOUSE Lysophosphatidylserine lipase ABHD12 OS=Mus musculus OX=10090 GN=Abhd12 PE=1 SV=2
4	Q7Z5M8	1.05e-93	287	362	0.364	0.401	AB12B_HUMAN Protein ABHD12B OS=Homo sapiens OX=9606 GN=ABHD12B PE=1 SV=1
5	P9WLC7	1.81e-20	92.8	281	0.153	0.217	Y2307_MYCTU Uncharacterized protein Rv2307c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2307c PE=1 SV=1
6	P54069	1.62e-15	78.6	299	0.141	0.187	BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bem46 PE=2 SV=3
7	Q80UX8	4.69e-14	74.7	337	0.143	0.169	ABHDD_MOUSE Protein ABHD13 OS=Mus musculus OX=10090 GN=Abhd13 PE=2 SV=1
8	Q4GYA0	3.23e-13	73.6	670	0.151	0.090	Q4GYA0_TRYB2 Serine peptidase, putative serine peptidase, Clan SC, Family S9D OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4780 PE=4 SV=1
9	Q21221	3.30e-13	72.4	332	0.141	0.169	AHO3_CAEEL Alpha/beta hydrolase domain-containing protein aho-3 OS=Caenorhabditis elegans OX=6239 GN=aho-3 PE=1 SV=2
10	Q8RXP6	1.91e-12	69.7	308	0.183	0.237	WAV2_ARATH Alpha/beta hydrolase domain-containing protein WAV2 OS=Arabidopsis thaliana OX=3702 GN=WAV2 PE=2 SV=1
11	Q38DS6	2.71e-12	69.7	370	0.166	0.178	Q38DS6_TRYB2 Bem46-like serine peptidase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2310 PE=4 SV=1
12	Q9S7U7	6.98e-12	68.6	361	0.156	0.172	Q9S7U7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F28J7.1 PE=1 SV=1
13	Q7L211	1.43e-11	67.4	337	0.138	0.163	ABHDD_HUMAN Protein ABHD13 OS=Homo sapiens OX=9606 GN=ABHD13 PE=2 SV=1
14	Q96GS6	6.71e-11	65.1	310	0.166	0.213	AB17A_HUMAN Alpha/beta hydrolase domain-containing protein 17A OS=Homo sapiens OX=9606 GN=ABHD17A PE=1 SV=1
15	Q5XIJ5	1.45e-10	64.3	310	0.131	0.168	AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus OX=10116 GN=Abhd17a PE=1 SV=1
16	Q84JV3	1.97e-10	63.5	294	0.121	0.163	Q84JV3_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g31020 PE=1 SV=1
17	Q8VYT1	4.33e-10	62.4	272	0.121	0.176	Q8VYT1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g66900 PE=1 SV=1
18	Q6AY17	3.02e-09	60.1	288	0.123	0.170	AB17B_RAT Alpha/beta hydrolase domain-containing protein 17B OS=Rattus norvegicus OX=10116 GN=Abhd17b PE=1 SV=1
19	Q7M759	3.02e-09	60.1	288	0.123	0.170	AB17B_MOUSE Alpha/beta hydrolase domain-containing protein 17B OS=Mus musculus OX=10090 GN=Abhd17b PE=1 SV=1
20	Q5VST6	4.16e-09	59.7	288	0.123	0.170	AB17B_HUMAN Alpha/beta hydrolase domain-containing protein 17B OS=Homo sapiens OX=9606 GN=ABHD17B PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	3.6e-12	58.0	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	1.9e+02	13.1	Alpha/beta hydrolase domain
3	PF02230 Abhydrolase_2	4.1e+02	12.2	Phospholipase/Carboxylesterase
4	PF07859 Abhydrolase_3	0.65	21.4	alpha/beta hydrolase fold
5	PF12697 Abhydrolase_6	9.5e-06	37.9	Alpha/beta hydrolase family
6	PF20434 BD-FAE	1.9	19.5	BD-FAE
7	PF12146 Hydrolase_4	1e-15	69.2	Serine aminopeptidase, S33
8	PF03583 LIP	4.5e+02	11.5	Secretory lipase
9	PF02129 Peptidase_S15	62	14.6	X-Pro dipeptidyl-peptidase (S15 family)
10	PF00326 Peptidase_S9	11	17.0	Prolyl oligopeptidase family
11	PF10340 Say1_Mug180	3.2e+02	11.6	Steryl acetyl hydrolase
12	PF00975 Thioesterase	30	16.2	Thioesterase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000022871

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000026006	0.730	Abhydrolase domain containing 6
2	9598.ENSPTRP00000055799	0.710	Monoglyceride lipase
3	9598.ENSPTRP00000013371	0.707	Glycerophosphodiester phosphodiesterase 1
4	9598.ENSPTRP00000001206	0.705	Uncharacterized protein
5	9598.ENSPTRP00000006442	0.696	Diacylglycerol lipase, alpha
6	9598.ENSPTRP00000033471	0.683	N-acyl phosphatidylethanolamine phospholipase D
7	9598.ENSPTRP00000030679	0.679	Abhydrolase domain containing 16A
8	9598.ENSPTRP00000055363	0.669	Cannabinoid receptor 1
9	9598.ENSPTRP00000010412	0.643	Abhydrolase domain containing 4
10	9598.ENSPTRP00000012541	0.640	Calcium and integrin binding family member 2
11	9598.ENSPTRP00000043964	0.624	Myotrophin
12	9598.ENSPTRP00000025534	0.601	Abhydrolase domain containing 5
13	9598.ENSPTRP00000001282	0.596	Sterol carrier protein 2
14	9598.ENSPTRP00000033528	0.594	Pendrin
15	9598.ENSPTRP00000059803	0.574	Clarin 1
16	9598.ENSPTRP00000048221	0.562	Uncharacterized protein
17	9598.ENSPTRP00000044726	0.552	Uncharacterized protein
18	9598.ENSPTRP00000027800	0.548	Belongs to the acid ceramidase family.
19	9598.ENSPTRP00000022263	0.537	G protein-coupled receptor 55
20	9598.ENSPTRP00000029219	0.530	Belongs to the G-protein coupled receptor 2 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047372	1.000	acylglycerol lipase activity
GO:0004622	1.000	lysophospholipase activity
GO:0005515	0.638	protein binding
GO:0140096	0.360	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044255	0.995	cellular lipid metabolic process
GO:0046486	0.994	glycerolipid metabolic process
GO:0044242	0.990	cellular lipid catabolic process
GO:0019637	0.988	organophosphate metabolic process
GO:0006796	0.986	phosphate-containing compound metabolic process
GO:0006638	0.982	neutral lipid metabolic process
GO:0046503	0.982	glycerolipid catabolic process
GO:0046464	0.972	acylglycerol catabolic process
GO:0046475	0.971	glycerophospholipid catabolic process
GO:0006575	0.962	cellular modified amino acid metabolic process
GO:0042219	0.950	cellular modified amino acid catabolic process
GO:0065007	0.501	biological regulation
GO:0032501	0.410	multicellular organismal process
GO:0050789	0.393	regulation of biological process
GO:0050896	0.322	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0031090	1.000	organelle membrane
GO:0005783	1.000	endoplasmic reticulum
GO:0042175	0.996	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.995	organelle subcompartment
GO:0005789	0.993	endoplasmic reticulum membrane
GO:0032991	0.511	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34019	1.000	a 1-acylglycerol + H2O = a fatty acid + glycerol + H(+)
EC:3.1.1.23	1.000	acylglycerol lipase.
RHEA:15177	1.000	a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine
EC:3.1.1.5	1.000	lysophospholipase.

[back to server]