StarFunc result for job id Q8N2K1

User Input

>input (259 residues)
MSSTSSKRAPTTATQRLKQDYLRIKKDPVPYICAEPLPSNILEWHYVVRGPEMTPYEGGY
YHGKLIFPREFPFKPPSIYMITPNGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLS
FMVEKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKAQDELSSR
PQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIV
GFAAFAYTVKYVLRSIAQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P073	0.804	0.804	7.011E-45	259	0.942	0.942	Q6P073.pdb.gz	UB2J2_MOUSE Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus OX=10090 GN=Ube2j2 PE=1 SV=1
2	AFDB:Q9SHI7	0.632	0.690	2.868E-26	237	0.378	0.414	Q9SHI7.pdb.gz	UBC34_ARATH Ubiquitin-conjugating enzyme E2 34 OS=Arabidopsis thaliana OX=3702 GN=UBC34 PE=2 SV=1
3	AFDB:Q9FK29	0.625	0.666	3.047E-26	243	0.390	0.416	Q9FK29.pdb.gz	UBC33_ARATH Probable ubiquitin-conjugating enzyme E2 33 OS=Arabidopsis thaliana OX=3702 GN=UBC33 PE=2 SV=1
4	AFDB:P33296	0.609	0.631	1.001E-23	250	0.363	0.376	P33296.pdb.gz	UBC6_YEAST Ubiquitin-conjugating enzyme E2 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC6 PE=1 SV=1
5	AFDB:Q9N490	0.597	0.704	1.252E-21	218	0.340	0.404	Q9N490.pdb.gz	Q9N490_CAEEL UBC core domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ubc-15 PE=1 SV=2
6	AFDB:Q583Z6	0.620	0.727	1.090E-19	220	0.282	0.332	Q583Z6.pdb.gz	Q583Z6_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.480 PE=4 SV=1
7	AFDB:Q9LSP7	0.543	0.460	2.671E-18	309	0.301	0.252	Q9LSP7.pdb.gz	UBC32_ARATH Ubiquitin-conjugating enzyme E2 32 OS=Arabidopsis thaliana OX=3702 GN=UBC32 PE=2 SV=1
8	AFDB:Q9JJZ4	0.505	0.414	1.958E-17	318	0.309	0.252	Q9JJZ4.pdb.gz	UB2J1_MOUSE Ubiquitin-conjugating enzyme E2 J1 OS=Mus musculus OX=10090 GN=Ube2j1 PE=1 SV=2
9	AFDB:P52478	0.407	0.541	2.094E-11	192	0.201	0.271	P52478.pdb.gz	UBC1_CAEEL Ubiquitin-conjugating enzyme E2 1 OS=Caenorhabditis elegans OX=6239 GN=ubc-1 PE=1 SV=1
10	PDB:2aakA	0.445	0.743	4.326E-11	150	0.151	0.260	2aakA.pdb.gz
11	AFDB:O74201	0.465	0.655	9.468E-11	179	0.189	0.274	O74201.pdb.gz	UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBC2 PE=2 SV=1
12	PDB:3bzhA	0.451	0.704	2.345E-10	161	0.158	0.255	3bzhA.pdb.gz
13	PDB:6cyrA	0.466	0.765	2.345E-10	153	0.166	0.281	6cyrA.pdb.gz
14	PDB:2cyxA	0.482	0.722	8.328E-10	169	0.154	0.237	2cyxA.pdb.gz
15	PDB:3ongB	0.394	0.625	1.196E-9	158	0.139	0.228	3ongB.pdb.gz
16	PDB:3rczB	0.430	0.687	1.350E-9	155	0.120	0.200	3rczB.pdb.gz
17	PDB:4m1nC	0.442	0.683	1.718E-9	160	0.135	0.219	4m1nC.pdb.gz
18	PDB:5aieB	0.438	0.723	4.249E-9	150	0.131	0.227	5aieB.pdb.gz	Architecture of the Ubiquitylation Module of the Yeast Ccr4-not Complex.
19	PDB:6d68A	0.457	0.722	4.249E-9	159	0.127	0.208	6d68A.pdb.gz
20	PDB:3ptfA	0.454	0.743	5.410E-9	153	0.131	0.222	3ptfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P073	0.0	509	259	0.942	0.942	UB2J2_MOUSE Ubiquitin-conjugating enzyme E2 J2 OS=Mus musculus OX=10090 GN=Ube2j2 PE=1 SV=1
2	Q8N2K1	0.0	540	259	1.000	1.000	UB2J2_HUMAN Ubiquitin-conjugating enzyme E2 J2 OS=Homo sapiens OX=9606 GN=UBE2J2 PE=1 SV=3
3	Q9FK29	1.51e-64	203	243	0.398	0.424	UBC33_ARATH Probable ubiquitin-conjugating enzyme E2 33 OS=Arabidopsis thaliana OX=3702 GN=UBC33 PE=2 SV=1
4	P33296	1.11e-62	199	250	0.359	0.372	UBC6_YEAST Ubiquitin-conjugating enzyme E2 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBC6 PE=1 SV=1
5	Q9SHI7	2.66e-62	197	237	0.340	0.371	UBC34_ARATH Ubiquitin-conjugating enzyme E2 34 OS=Arabidopsis thaliana OX=3702 GN=UBC34 PE=2 SV=1
6	Q9N490	1.69e-51	169	218	0.309	0.367	Q9N490_CAEEL UBC core domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ubc-15 PE=1 SV=2
7	Q583Z6	2.22e-41	143	220	0.274	0.323	Q583Z6_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2H8.480 PE=4 SV=1
8	Q9LSP7	6.23e-38	137	309	0.224	0.188	UBC32_ARATH Ubiquitin-conjugating enzyme E2 32 OS=Arabidopsis thaliana OX=3702 GN=UBC32 PE=2 SV=1
9	Q9Y385	5.69e-37	134	318	0.228	0.186	UB2J1_HUMAN Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2
10	Q9JJZ4	9.25e-37	134	318	0.228	0.186	UB2J1_MOUSE Ubiquitin-conjugating enzyme E2 J1 OS=Mus musculus OX=10090 GN=Ube2j1 PE=1 SV=2
11	P06104	1.06e-17	80.1	172	0.170	0.256	UBC2_YEAST Ubiquitin-conjugating enzyme E2 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD6 PE=1 SV=1
12	O74201	1.85e-17	79.7	179	0.189	0.274	UBC2_CANAL Ubiquitin-conjugating enzyme E2 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UBC2 PE=2 SV=1
13	P63146	5.20e-17	77.8	152	0.162	0.276	UBE2B_HUMAN Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1
14	P63147	5.20e-17	77.8	152	0.162	0.276	UBE2B_MOUSE Ubiquitin-conjugating enzyme E2 B OS=Mus musculus OX=10090 GN=Ube2b PE=1 SV=1
15	P63149	5.20e-17	77.8	152	0.162	0.276	UBE2B_RAT Ubiquitin-conjugating enzyme E2 B OS=Rattus norvegicus OX=10116 GN=Ube2b PE=2 SV=1
16	P49459	1.51e-16	76.6	152	0.158	0.270	UBE2A_HUMAN Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A PE=1 SV=2
17	Q9Z255	1.51e-16	76.6	152	0.158	0.270	UBE2A_MOUSE Ubiquitin-conjugating enzyme E2 A OS=Mus musculus OX=10090 GN=Ube2a PE=1 SV=1
18	P23566	2.17e-16	76.3	151	0.154	0.265	UBC2_SCHPO Ubiquitin-conjugating enzyme E2 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rhp6 PE=1 SV=3
19	P42745	3.53e-16	75.5	152	0.151	0.257	UBC2_ARATH Ubiquitin-conjugating enzyme E2 2 OS=Arabidopsis thaliana OX=3702 GN=UBC2 PE=2 SV=1
20	P25865	4.04e-16	75.5	152	0.151	0.257	UBC1_ARATH Ubiquitin-conjugating enzyme E2 1 OS=Arabidopsis thaliana OX=3702 GN=UBC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00179 UQ_con	3.9e-15	67.2	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000002333

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000012839	0.925	Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'- linked polyubiquitination. Involved in endoplasmic reticulum-associated degradation (ERAD)
2	9601.ENSPPYP00000016237	0.847	Transmembrane protein 129, E3 ubiquitin protein ligase
3	9601.ENSPPYP00000020192	0.846	Ubiquitin-conjugating enzyme E2H
4	9601.ENSPPYP00000017141	0.834	E3 ubiquitin-protein ligase that promotes 'Lys-48'-linked ubiquitination of target proteins, leading to their proteasomal degradation. Promotes ubiquitination of DIO2, leading to its degradation. Promotes ubiquitination of SQLE, leading to its degradation. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates. May cooperate with UBE2G1
5	9601.ENSPPYP00000024080	0.831	annotation not available
6	9601.ENSPPYP00000022706	0.818	Ubiquitin-like modifier activating enzyme 1
7	9601.ENSPPYP00000016457	0.807	Ubiquitin-like modifier activating enzyme 6
8	9601.ENSPPYP00000011677	0.803	Ubiquitin-conjugating enzyme E2S
9	9601.ENSPPYP00000015508	0.800	Ubiquitin-like modifier activating enzyme 7
10	9601.ENSPPYP00000008392	0.794	NEDD8 activating enzyme E1 subunit 1
11	9601.ENSPPYP00000020831	0.778	Ubiquitin-conjugating enzyme E2 variant 2
12	9601.ENSPPYP00000001485	0.768	Ubiquitin-conjugating enzyme E2U (putative)
13	9601.ENSPPYP00000011779	0.766	Ubiquitin-conjugating enzyme E2M
14	9601.ENSPPYP00000015785	0.746	E1-like enzyme which activates UFM1 and SUMO2.
15	9601.ENSPPYP00000012370	0.744	Ubiquitin-conjugating enzyme E2C
16	9601.ENSPPYP00000009725	0.741	Ubiquitin-conjugating enzyme E2O
17	9601.ENSPPYP00000021408	0.741	Valosin containing protein
18	9601.ENSPPYP00000014892	0.740	Ubiquitin-conjugating enzyme E2F (putative)
19	9601.ENSPPYP00000016399	0.740	Ubiquitin-conjugating enzyme E2K
20	9601.ENSPPYP00000000906	0.733	Ubiquitin-conjugating enzyme E2Q family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	1.000	ubiquitin protein ligase binding
GO:0061631	0.999	ubiquitin conjugating enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.987	primary metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.986	macromolecule metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0050794	0.982	regulation of cellular process
GO:0030163	0.982	protein catabolic process
GO:0044260	0.981	cellular macromolecule metabolic process
GO:0019941	0.957	modification-dependent protein catabolic process
GO:0030433	0.939	ubiquitin-dependent ERAD pathway
GO:0033157	0.881	regulation of intracellular protein transport
GO:0032388	0.876	positive regulation of intracellular transport
GO:1904951	0.811	positive regulation of establishment of protein localization
GO:0090316	0.799	positive regulation of intracellular protein transport
GO:1903747	0.716	regulation of establishment of protein localization to mitochondrion
GO:1903533	0.715	regulation of protein targeting
GO:0036211	0.605	protein modification process
GO:0032446	0.554	protein modification by small protein conjugation
GO:0016567	0.490	protein ubiquitination
GO:0000209	0.353	protein polyubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005783	0.979	endoplasmic reticulum
GO:0016020	0.609	membrane
GO:0005829	0.567	cytosol
GO:0032991	0.490	protein-containing complex
GO:0005634	0.483	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.2.23	0.999	E2 ubiquitin-conjugating enzyme.

[back to server]