StarFunc result for job id Q8N2N9

User Input

>input (1353 residues)
MERLCSDGFAFPHYYIKPYHLKRIHRAVLRGNLEKLKYLLLTYYDANKRDRKERTALHLA
CATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQNGADPNITDVFGR
TALHYAVYNEDTSMIEKLLSHGTNIEECSKNEYQPLLLAVSRRKVKMVEFLLKKKANVNA
IDYLGRSALILAVTLGEKDIVILLLQHNIDVFSRDVYGKLAEDYASEAENRVIFDLIYEY
KRKRYEDLPINSNPVSPQKQRAEKATSDDKDSVSNIATEIKEGPISGTVSSQKQPAEKAT
SDEKDSVSNIATEIKEGQQSGTVSPQKQSAQKVIFKKKVSLLNIATRIMGGGKSGTVSSQ
KQPASKTASDKTDSALNTATEIKDGLQCGTVSSQKQQALKATTDEEGSVSNIATEIKDGE
KSGTVSSQKKPALKATSDEKDSFSNITREKKDGEISRTVSSQKPPALKATSVKEDSVLNI
AREKKDGEKSRTVSFEQPPGLKATRDEKDSLLNIARGKKDGEKTRRVSSHKQPSLKATSD
KEDSVPNMATETKDEQISGTVSCQKQPALKATSDKKDSVSNIPTEIKDGQQSGTVSSQKQ
PAWKATSVKKDSVSNIATEIKDGQIRGTVSSQRRPALKTTGDEKDSVSNIAREIKDGEKS
GTVSPQKQSAQKVIFKKKVSLLNIATRITGGGKSGTEYPENLRTLKATIENKDSVLNTAT
KMKEVQTSTPAEQDLEMASEGEQKRLEEYENNQPQVKNQIHSRDDLDDIIQSSQTVSEDG
DSLCCNCKNVILLIDQHEMKCKDCVHLLKIKNTFCLWKRLIKLKDNHCEQLRVKIRKLKN
KASVLQKRISEKEEIKSQLKHEILELEKELCSLRFAIQQEKKKRRNVEELHQKVREKLRI
TEEQYRIEADVTKPIKPALKSAEVELKTGGNNSNQVSETDEKEDLLHENRLMQDEIARLR
LEKDTIKNQNLEKKYLKDFEIVKRKHEDLQKALKRNGETLAKTIACYSGQLAALTDENTT
LRSKLEKQRESRQRLETEMQSYRCRLNAARCDHDQSHSSKRDQELAFQGTVDKCRHLQEN
LNSHVLILSLQLSKAESKSRVLKTELHYTGEALKEKALVFEHVQSELKQKQSQMKDIEKM
YKSGYNTMEKCIEKQERFCQLKKQNMLLQQQLDDARNKADNQEKAILNIQARCDARVQNL
QAECRKHRLLLEEDNKMLVNELNHSKEKECQYEKEKAEREVAVRQLQQKRDDVLNKGSAT
KALLDASSRHCTYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEMEGDTQKLEVEH
VMMRKIIKKQDDQIERLEKILQHSSLMLQVFES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2N9	1.000	1.000	0.000	1353	1.000	1.000	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
2	AFDB:Q9UPS8	0.135	0.124	9.417E-51	1710	0.353	0.280	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
3	AFDB:Q811D2	0.128	0.110	5.199E-42	1581	0.300	0.257	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
4	AFDB:Q86RA0	0.091	0.132	1.336E-14	927	0.110	0.161	Q86RA0.pdb.gz	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
5	AFDB:O60237	0.099	0.128	4.233E-14	982	0.115	0.159	O60237.pdb.gz	MYPT2_HUMAN Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=2
6	PDB:8cs9A	0.159	0.267	7.228E-14	796	0.047	0.079	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
7	AFDB:Q90623	0.091	0.111	2.387E-13	1004	0.105	0.141	Q90623.pdb.gz	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
8	PDB:2dvwA	0.159	0.877	4.771E-13	229	0.041	0.245	2dvwA.pdb.gz
9	AFDB:M9PCQ3	0.094	0.108	5.240E-13	1111	0.133	0.162	M9PCQ3.pdb.gz	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
10	AFDB:P0C6S7	0.164	0.176	7.971E-13	1260	0.085	0.091	P0C6S7.pdb.gz	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
11	AFDB:Q8IQN4	0.095	0.105	9.328E-13	1144	0.129	0.153	Q8IQN4.pdb.gz	Q8IQN4_DROME FI18194p1 OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=2
12	AFDB:G5EG29	0.098	0.123	1.036E-12	968	0.120	0.167	G5EG29.pdb.gz	G5EG29_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
13	PDB:4oauC	0.133	0.240	3.161E-11	692	0.044	0.087	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:6v9hC	0.144	0.667	6.940E-11	270	0.036	0.181	6v9hC.pdb.gz
15	PDB:5vkqA	0.150	0.136	6.967E-10	1499	0.044	0.040	5vkqA.pdb.gz
16	PDB:1wg0A	0.129	0.666	2.451E-9	243	0.036	0.202	1wg0A.pdb.gz
17	PDB:6aunA	0.143	0.298	4.363E-9	618	0.043	0.094	6aunA.pdb.gz
18	PDB:6mwqA	0.110	0.294	4.380E-8	493	0.036	0.099	6mwqA.pdb.gz
19	PDB:6jd6B	0.120	0.782	6.322E-8	192	0.036	0.255	6jd6B.pdb.gz
20	PDB:6pqpA	0.126	0.268	1.013E-7	615	0.032	0.070	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N2N9	0.0	2768	1353	1.000	1.000	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
2	A1A5B0	2.27e-172	516	309	0.183	0.799	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
3	Q9UPS8	1.23e-157	520	1710	0.230	0.182	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
4	Q811D2	1.09e-111	388	1581	0.186	0.159	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
5	A0JP26	7.77e-64	230	581	0.087	0.203	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
6	Q5TYW2	4.11e-63	234	823	0.082	0.135	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
7	Q6S8J3	1.55e-60	229	1075	0.087	0.110	POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3
8	A5A3E0	2.06e-60	229	1075	0.087	0.110	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
9	P0CG39	7.59e-59	223	1038	0.086	0.112	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
10	P0CG38	7.68e-59	224	1075	0.086	0.108	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
11	Q9D504	2.02e-58	205	279	0.077	0.373	ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus OX=10090 GN=Ankrd7 PE=2 SV=2
12	Q6NSI1	9.77e-51	184	321	0.066	0.277	AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens OX=9606 GN=ANKRD26P1 PE=5 SV=2
13	A0A140VJE5	1.99e-48	175	254	0.069	0.366	A0A140VJE5_HUMAN Testicular tissue protein Li 19 OS=Homo sapiens OX=9606 PE=2 SV=1
14	Q92527	1.99e-48	175	254	0.069	0.366	ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=2 SV=3
15	C9JIJ7	8.56e-48	174	263	0.069	0.357	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
16	Q96IX9	4.60e-42	152	119	0.058	0.664	A26L1_HUMAN Putative ankyrin repeat domain-containing protein 26-like 1 OS=Homo sapiens OX=9606 GN=ANKRD36BP1 PE=5 SV=1
17	Q54KA7	9.37e-22	105	986	0.052	0.072	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
18	Q8GZ22	2.78e-20	94.0	240	0.043	0.242	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
19	A0A5F9ZHF7	1.18e-18	95.5	3862	0.046	0.016	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1
20	A0A5F9ZHT8	1.18e-18	95.5	3891	0.046	0.016	A0A5F9ZHT8_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	9.3e-18	75.0	Ankyrin repeat
2	PF12796 Ank_2	7.3e-27	105.1	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.1e-17	73.1	Ankyrin repeat
4	PF13637 Ank_4	1.3e-26	103.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1.9e-16	71.2	Ankyrin repeats (many copies)
6	PF14915 CCDC144C	3.8e-99	343.3	CCDC144C protein coiled-coil region
7	PF19890 DUF6363	97	14.2	Domain of unknown function (DUF6363)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481149

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000444747	0.620	Zinc finger protein 835
2	9606.ENSP00000335623	0.562	V-set and immunoglobulin domain containing 10 like
3	9606.ENSP00000324369	0.520	Olfactory receptor 2T35
4	9606.ENSP00000358512	0.517	Protein mab-21-like 3
5	9606.ENSP00000397188	0.507	Family with sequence similarity 104 member B
6	9606.ENSP00000312299	0.505	Protein FRG2-like-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.701	regulation of biological process
GO:0050794	0.590	regulation of cellular process
GO:0000003	0.443	reproduction
GO:0008152	0.409	metabolic process
GO:0022414	0.399	reproductive process
GO:0071704	0.375	organic substance metabolic process
GO:0032501	0.369	multicellular organismal process
GO:0030317	0.357	flagellated sperm motility
GO:0050896	0.311	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.999	intracellular anatomical structure
GO:0043227	0.999	membrane-bounded organelle
GO:0043231	0.993	intracellular membrane-bounded organelle
GO:0005634	0.959	nucleus
GO:0016020	0.867	membrane
GO:0070013	0.679	intracellular organelle lumen
GO:0071944	0.545	cell periphery
GO:0043232	0.475	intracellular non-membrane-bounded organelle
GO:0031981	0.472	nuclear lumen
GO:0005654	0.461	nucleoplasm
GO:0005886	0.384	plasma membrane
GO:0005737	0.381	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]