StarFunc result for job id Q8N2S1

User Input

>input (1624 residues)
MPRPGTSGRRPLLLVLLLPLFAAATSAASPSPSPSQVVEVPGVPSRPASVAVCRCCPGQT
SRRSRCIRAFCRVRSCQPKKCAGPQRCLNPVPAVPSPSPSVRKRQVSLNWQPLTLQEARA
LLKRRRPRGPGGRGLLRRRPPQRAPAGKAPVLCPLICHNGGVCVKPDRCLCPPDFAGKFC
QLHSSGARPPAPAVPGLTRSVYTMPLANHRDDEHGVASMVSVHVEHPQEASVVVHQVERV
SGPWEEADAEAVARAEAAARAEAAAPYTVLAQSAPREDGYSDASGFGYCFRELRGGECAS
PLPGLRTQEVCCRGAGLAWGVHDCQLCSERLGNSERVSAPDGPCPTGFERVNGSCEDVDE
CATGGRCQHGECANTRGGYTCVCPDGFLLDSSRSSCISQHVISEAKGPCFRVLRDGGCSL
PILRNITKQICCCSRVGKAWGRGCQLCPPFGSEGFREICPAGPGYHYSASDLRYNTRPLG
QEPPRVSLSQPRTLPATSRPSAGFLPTHRLEPRPEPRPDPRPGPELPLPSIPAWTGPEIP
ESGPSSGMCQRNPQVCGPGRCISRPSGYTCACDSGFRLSPQGTRCIDVDECRRVPPPCAP
GRCENSPGSFRCVCGPGFRAGPRAAECLDVDECHRVPPPCDLGRCENTPGSFLCVCPAGY
QAAPHGASCQDVDECTQSPGLCGRGACKNLPGSFRCVCPAGFRGSACEEDVDECAQEPPP
CGPGRCDNTAGSFHCACPAGFRSRGPGAPCQDVDECARSPPPCTYGRCENTEGSFQCVCP
MGFQPNTAGSECEDVDECENHLACPGQECVNSPGSFQCRTCPSGHHLHRGRCTDVDECSS
GAPPCGPHGHCTNTEGSFRCSCAPGYRAPSGRPGPCADVNECLEGDFCFPHGECLNTDGS
FACTCAPGYRPGPRGASCLDVDECSEEDLCQSGICTNTDGSFECICPPGHRAGPDLASCL
DVDECRERGPALCGSQRCENSPGSYRCVRDCDPGYHAGPEGTCDDVDECQEYGPEICGAQ
RCENTPGSYRCTPACDPGYQPTPGGGCQDVDECRNRSFCGAHAVCQNLPGSFQCLCDQGY
EGARDGRHCVDVNECETLQGVCGAALCENVEGSFLCVCPNSPEEFDPMTGRCVPPRTSAG
TFPGSQPQAPASPVLPARPPPPPLPRRPSTPRQGPVGSGRRECYFDTAAPDACDNILARN
VTWQECCCTVGEGWGSGCRIQQCPGTETAEYQSLCPHGRGYLAPSGDLSLRRDVDECQLF
RDQVCKSGVCVNTAPGYSCYCSNGYYYHTQRLECIDNDECADEEPACEGGRCVNTVGSYH
CTCEPPLVLDGSQRRCVSNESQSLDDNLGVCWQEVGADLVCSHPRLDRQATYTECCCLYG
EAWGMDCALCPAQDSDDFEALCNVLRPPAYSPPRPGGFGLPYEYGPDLGPPYQGLPYGPE
LYPPPALPYDPYPPPPGPFARREAPYGAPRFDMPDFEDDGGPYGESEAPAPPGPGTRWPY
RSRDTRRSFPEPEEPPEGGSYAGSLAEPYEELEAEECGILDGCTNGRCVRVPEGFTCRCF
DGYRLDMTRMACVDINECDEAEAASPLCVNARCLNTDGSFRCICRPGFAPTHQPHHCAPA
RPRA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K4G1	0.260	0.255	0.000	1666	0.887	0.865	Q8K4G1.pdb.gz	LTBP4_MOUSE Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus OX=10090 GN=Ltbp4 PE=1 SV=2
2	AFDB:Q8N2S1	1.000	1.000	0.000	1624	1.000	1.000	Q8N2S1.pdb.gz	LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2
3	PDB:7q3nU	0.064	0.233	5.152E-7	292	0.029	0.161	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
4	AFDB:E9Q7X6	0.050	0.057	3.970E-6	1337	0.127	0.154	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
5	AFDB:Q9ULI3	0.045	0.053	1.199E-4	1381	0.102	0.119	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
6	AFDB:Q04164	0.054	0.053	3.052E-4	1693	0.122	0.117	Q04164.pdb.gz	SAS_DROME Putative epidermal cell surface receptor OS=Drosophila melanogaster OX=7227 GN=sas PE=2 SV=2
7	AFDB:A1Z6W9	0.052	0.059	3.803E-4	1363	0.139	0.165	A1Z6W9.pdb.gz	A1Z6W9_DROME Pawn, isoform B OS=Drosophila melanogaster OX=7227 GN=pwn PE=4 SV=2
8	AFDB:A0A2R8QK78	0.038	0.038	8.209E-4	1570	0.087	0.090	A0A2R8QK78.pdb.gz
9	PDB:7nycC	0.049	0.074	5.574E-3	809	0.036	0.073	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
10	PDB:4e0sB	0.037	0.049	8.189E-3	898	0.041	0.075	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
11	PDB:3t5oA	0.026	0.043	1.078E-2	871	0.039	0.073	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
12	PDB:3b4vD	0.046	0.180	1.868E-2	213	0.023	0.174	3b4vD.pdb.gz
13	AFDB:Q9W283	0.027	0.029	4.295E-2	1329	0.128	0.157	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
14	PDB:5es4B	0.043	0.076	5.924E-2	674	0.029	0.070	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
15	PDB:6pxvA	0.031	0.049	2.916E-1	823	0.023	0.045	6pxvA.pdb.gz
16	PDB:7n9qA	0.047	0.039	3.439E-1	2315	0.033	0.023	7n9qA.pdb.gz
17	AFDB:Q9EPQ8	0.029	0.027	4.090E-1	1987	0.161	0.131	Q9EPQ8.pdb.gz	TCF20_MOUSE Transcription factor 20 OS=Mus musculus OX=10090 GN=Tcf20 PE=1 SV=3
18	AFDB:Q9SIV5	0.033	0.032	4.565E-1	1773	0.140	0.129	Q9SIV5.pdb.gz	C3H19_ARATH Zinc finger CCCH domain-containing protein 19 OS=Arabidopsis thaliana OX=3702 GN=NERD PE=1 SV=3
19	PDB:7n9sA	0.037	0.029	7.027E-1	2365	0.038	0.026	7n9sA.pdb.gz
20	PDB:6h03C	0.019	0.054	1.032	513	0.010	0.031	6h03C.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7YY58	0.0	594	1338	0.272	0.330	A7YY58_BOVIN LTBP1 protein OS=Bos taurus OX=9913 GN=LTBP1 PE=2 SV=1
2	F1MF86	0.0	931	1963	0.387	0.320	F1MF86_BOVIN Latent transforming growth factor beta binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=4 SV=1
3	O08999	0.0	871	1813	0.364	0.326	LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus OX=10090 GN=Ltbp2 PE=1 SV=2
4	Q00918	0.0	593	1712	0.281	0.266	LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ltbp1 PE=1 SV=1
5	Q14766	0.0	593	1721	0.278	0.263	LTBP1_HUMAN Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 PE=1 SV=4
6	Q14767	0.0	918	1821	0.379	0.338	LTBP2_HUMAN Latent-transforming growth factor beta-binding protein 2 OS=Homo sapiens OX=9606 GN=LTBP2 PE=1 SV=3
7	Q28019	0.0	927	1842	0.387	0.341	LTBP2_BOVIN Latent-transforming growth factor beta-binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=1 SV=2
8	Q8CG19	0.0	592	1712	0.278	0.263	LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus OX=10090 GN=Ltbp1 PE=1 SV=2
9	Q8K4G1	0.0	2674	1666	0.874	0.852	LTBP4_MOUSE Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus OX=10090 GN=Ltbp4 PE=1 SV=2
10	Q8N2S1	0.0	3202	1624	1.000	1.000	LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2
11	B7ZLY3	3.45e-173	560	1353	0.196	0.235	B7ZLY3_HUMAN LTBP1 protein OS=Homo sapiens OX=9606 GN=LTBP1 PE=2 SV=1
12	Q9NS15	7.36e-132	446	1303	0.262	0.326	LTBP3_HUMAN Latent-transforming growth factor beta-binding protein 3 OS=Homo sapiens OX=9606 GN=LTBP3 PE=1 SV=4
13	G3V9M6	7.86e-125	437	2872	0.262	0.148	G3V9M6_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
14	Q61554	1.20e-124	436	2873	0.262	0.148	FBN1_MOUSE Fibrillin-1 OS=Mus musculus OX=10090 GN=Fbn1 PE=1 SV=2
15	Q61555	3.23e-124	435	2907	0.252	0.141	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
16	P35556	2.53e-123	432	2912	0.252	0.141	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
17	Q9WUH8	3.91e-123	432	2872	0.259	0.146	Q9WUH8_RAT Fibrillin-1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=2 SV=1
18	P35555	2.42e-120	423	2871	0.225	0.127	FBN1_HUMAN Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4
19	A0A0G2KQ62	8.82e-119	418	2868	0.224	0.127	A0A0G2KQ62_DANRE Fibrillin 2b OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=2
20	B6CS38	1.68e-118	417	2868	0.224	0.127	B6CS38_DANRE Fibrillin 2 OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.1e-84	289.1	Complement Clr-like EGF-like
2	PF00008 EGF	2.7e-28	109.2	EGF-like domain
3	PF07974 EGF_2	2	20.1	EGF-like domain
4	PF12947 EGF_3	7e-37	136.6	EGF domain
5	PF07645 EGF_CA	7.4e-137	456.7	Calcium-binding EGF domain
6	PF14670 FXa_inhibition	1.2e-17	75.3	Coagulation Factor Xa inhibitory site
7	PF12661 hEGF	1.2e-19	81.4	Human growth factor-like EGF
8	PF00683 TB	9.9e-36	132.6	TB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311905

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221930	0.925	Transforming growth factor beta-1
2	9606.ENSP00000346839	0.908	Fibronectin type III domain containing
3	9606.ENSP00000356737	0.739	Golgin, RAB6 interacting
4	9606.ENSP00000218867	0.598	Gamma-sarcoglycan
5	9606.ENSP00000351807	0.573	Elastin
6	9606.ENSP00000351905	0.546	TGF-beta receptor type-2
7	9606.ENSP00000238682	0.530	Transforming growth factor beta-3
8	9606.ENSP00000384949	0.524	Pyrroline-5-carboxylate reductase 1, mitochondrial
9	9606.ENSP00000325527	0.515	Fibrillin-1
10	9606.ENSP00000346478	0.509	ADAMTS-like protein 2
11	9606.ENSP00000301873	0.500	Latent-transforming growth factor beta-binding protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019838	0.977	growth factor binding
GO:0019955	0.963	cytokine binding
GO:0050431	0.953	transforming growth factor beta binding
GO:0005509	0.929	calcium ion binding
GO:0005102	0.336	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.998	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0048583	0.851	regulation of response to stimulus
GO:0090092	0.837	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0090287	0.818	regulation of cellular response to growth factor stimulus
GO:0048518	0.742	positive regulation of biological process
GO:0048522	0.709	positive regulation of cellular process
GO:1903844	0.707	regulation of cellular response to transforming growth factor beta stimulus
GO:0050896	0.591	response to stimulus
GO:0048856	0.514	anatomical structure development
GO:0071840	0.513	cellular component organization or biogenesis
GO:0016043	0.467	cellular component organization
GO:0051716	0.446	cellular response to stimulus
GO:0048523	0.420	negative regulation of cellular process
GO:0023052	0.416	signaling
GO:0032501	0.413	multicellular organismal process
GO:0007154	0.412	cell communication
GO:0007275	0.364	multicellular organism development
GO:0070848	0.357	response to growth factor
GO:0051128	0.342	regulation of cellular component organization
GO:0006457	0.335	protein folding
GO:0071363	0.329	cellular response to growth factor stimulus
GO:0007165	0.321	signal transduction
GO:0017015	0.308	regulation of transforming growth factor beta receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.995	collagen-containing extracellular matrix
GO:0005576	0.982	extracellular region
GO:0005615	0.952	extracellular space
GO:0043226	0.919	organelle
GO:0005622	0.804	intracellular anatomical structure
GO:0043227	0.802	membrane-bounded organelle
GO:0005737	0.741	cytoplasm
GO:0043229	0.669	intracellular organelle
GO:0031974	0.385	membrane-enclosed lumen
GO:0099512	0.385	supramolecular fiber
GO:0043233	0.384	organelle lumen
GO:0043231	0.376	intracellular membrane-bounded organelle
GO:0001527	0.354	microfibril
GO:0031982	0.301	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]