StarFunc result for job id Q8N2W9

User Input

>input (510 residues)
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA
ILVLGPSDANGLLPAPSVNGSGALGSTGGGGPVGSMENGKPGADVVDLTLDSSSSSEDEE
EEEEEEEDEDEEGPRPKRRCPFQKGLVPAC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2W9	1.000	1.000	5.755E-97	510	1.000	1.000	Q8N2W9.pdb.gz	PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens OX=9606 GN=PIAS4 PE=1 SV=1
2	AFDB:F1R4C4	0.539	0.544	6.655E-61	505	0.590	0.596	F1R4C4.pdb.gz	PIS4A_DANRE E3 SUMO-protein ligase PIAS4-A OS=Danio rerio OX=7955 GN=pias4a PE=2 SV=2
3	AFDB:G3V9T0	0.565	0.447	9.322E-57	651	0.476	0.373	G3V9T0.pdb.gz	G3V9T0_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=1 SV=2
4	AFDB:O54714	0.543	0.447	2.693E-56	628	0.461	0.374	O54714.pdb.gz	PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus OX=10090 GN=Pias3 PE=1 SV=3
5	AFDB:A9UK05	0.567	0.450	3.409E-56	651	0.478	0.375	A9UK05.pdb.gz	A9UK05_RAT Protein inhibitor of activated STAT-1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=2 SV=1
6	AFDB:O75928	0.585	0.486	4.558E-55	621	0.465	0.382	O75928.pdb.gz	PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=9606 GN=PIAS2 PE=1 SV=3
7	AFDB:A1Z7P5	0.527	0.422	1.368E-49	640	0.388	0.309	A1Z7P5.pdb.gz	A1Z7P5_DROME Suppressor of variegation 2-10, isoform I OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
8	AFDB:Q94361	0.516	0.343	9.653E-37	780	0.284	0.186	Q94361.pdb.gz	GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans OX=6239 GN=gei-17 PE=1 SV=4
9	AFDB:C8V0C1	0.511	0.515	2.897E-31	504	0.216	0.218	C8V0C1.pdb.gz	C8V0C1_EMENI SUMO ligase SizA, putative (AFU_orthologue AFUA_6G05240) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10822 PE=3 SV=1
10	AFDB:Q04195	0.442	0.269	1.249E-27	904	0.204	0.115	Q04195.pdb.gz	SIZ1_YEAST E3 SUMO-protein ligase SIZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SIZ1 PE=1 SV=1
11	PDB:5eiyB	0.135	0.110	9.284E-3	658	0.084	0.065	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
12	PDB:3j4qB	0.083	0.103	2.528E-2	382	0.076	0.102	3j4qB.pdb.gz
13	PDB:5jm0A	0.129	0.076	3.601E-2	940	0.035	0.019	5jm0A.pdb.gz
14	PDB:1js9C	0.124	0.246	8.218E-2	189	0.047	0.127	1js9C.pdb.gz
15	PDB:6drvA	0.124	0.067	1.170E-1	1024	0.033	0.017	6drvA.pdb.gz
16	PDB:2wuxA	0.105	0.205	1.241E-1	213	0.039	0.094	2wuxA.pdb.gz
17	PDB:7bvfA	0.136	0.073	1.571E-1	1087	0.031	0.015	7bvfA.pdb.gz	Structures of cell wall arabinosyltransferases with the anti-tuberculosis drug ethambutol.
18	PDB:7drtB	0.068	0.070	1.989E-1	496	0.033	0.034	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
19	PDB:7l2zF	0.142	0.114	2.238E-1	664	0.051	0.039	7l2zF.pdb.gz
20	PDB:4uybA	0.103	0.124	2.374E-1	401	0.025	0.032	4uybA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R4C4	0.0	523	505	0.588	0.594	PIS4A_DANRE E3 SUMO-protein ligase PIAS4-A OS=Danio rerio OX=7955 GN=pias4a PE=2 SV=2
2	Q8N2W9	0.0	1042	510	1.000	1.000	PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens OX=9606 GN=PIAS4 PE=1 SV=1
3	Q9JM05	0.0	860	507	0.878	0.884	PIAS4_MOUSE E3 SUMO-protein ligase PIAS4 OS=Mus musculus OX=10090 GN=Pias4 PE=1 SV=2
4	Q5QGZ1	4.34e-143	424	564	0.431	0.390	Q5QGZ1_CHICK PIAS1 OS=Gallus gallus OX=9031 GN=PIAS1 PE=2 SV=1
5	A0A8I5Y680	1.16e-142	424	577	0.431	0.381	A0A8I5Y680_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
6	A0A8I6AIY4	1.84e-142	426	651	0.431	0.338	A0A8I6AIY4_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
7	A9UK05	2.57e-142	426	651	0.431	0.338	A9UK05_RAT Protein inhibitor of activated STAT-1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=2 SV=1
8	O88907	3.47e-142	425	651	0.431	0.338	PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus OX=10090 GN=Pias1 PE=1 SV=2
9	O75925	4.96e-142	425	651	0.429	0.336	PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens OX=9606 GN=PIAS1 PE=1 SV=2
10	A0A8I6AJT7	2.74e-141	423	658	0.427	0.331	A0A8I6AJT7_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=3 SV=1
11	O70260	2.99e-138	414	628	0.480	0.390	PIAS3_RAT E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus OX=10116 GN=Pias3 PE=1 SV=2
12	Q9Y6X2	3.83e-138	414	628	0.475	0.385	PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens OX=9606 GN=PIAS3 PE=1 SV=2
13	O54714	1.08e-136	410	628	0.465	0.377	PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus OX=10090 GN=Pias3 PE=1 SV=3
14	Q6AZ28	1.77e-136	408	572	0.469	0.418	PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus OX=10116 GN=Pias2 PE=1 SV=1
15	O75928	8.45e-136	408	621	0.473	0.388	PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens OX=9606 GN=PIAS2 PE=1 SV=3
16	Q6IAR4	2.91e-135	406	619	0.465	0.383	Q6IAR4_HUMAN PIAS3 protein OS=Homo sapiens OX=9606 GN=PIAS3 PE=2 SV=1
17	Q8C5D8	1.17e-134	405	621	0.467	0.383	PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus OX=10090 GN=Pias2 PE=1 SV=2
18	G3V9T0	3.77e-124	378	624	0.392	0.321	G3V9T0_RAT Protein inhibitor of activated STAT, 1 OS=Rattus norvegicus OX=10116 GN=Pias1 PE=1 SV=2
19	A0A0B4JCQ7	1.37e-106	330	537	0.363	0.345	A0A0B4JCQ7_DROME Suppressor of variegation 2-10, isoform K OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1
20	Q5BIG7	1.63e-106	330	533	0.363	0.347	Q5BIG7_DROME RE55465p OS=Drosophila melanogaster OX=7227 GN=Su(var)2-10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05395 DARPP-32	51	15.5	Protein phosphatase inhibitor 1/DARPP-32
2	PF14324 PINIT	6.2e-26	102.9	PINIT domain
3	PF02037 SAP	2.1e+02	13.1	SAP domain
4	PF02891 zf-MIZ	2.2e-18	77.1	MIZ/SP-RING zinc finger
5	PF11789 zf-Nse	0.9	20.8	Zinc-finger of the MIZ type in Nse subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262971

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348056	0.999	SUMO-conjugating enzyme UBC9
2	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
3	9606.ENSP00000332973	0.994	Mothers against decapentaplegic homolog 3
4	9606.ENSP00000405965	0.994	Small ubiquitin-related modifier 2
5	9606.ENSP00000269305	0.992	Cellular tumor antigen p53
6	9606.ENSP00000354394	0.991	Signal transducer and activator of transcription 1-alpha/beta
7	9606.ENSP00000367830	0.991	Protein kinase C zeta type
8	9606.ENSP00000341551	0.989	Mothers against decapentaplegic homolog 4
9	9606.ENSP00000355759	0.985	Poly [ADP-ribose] polymerase 1
10	9606.ENSP00000409666	0.983	Small ubiquitin-like modifier 3
11	9606.ENSP00000376077	0.980	Small ubiquitin-related modifier 1
12	9606.ENSP00000426503	0.977	E3 ubiquitin-protein ligase RNF4
13	9606.ENSP00000256474	0.971	Von Hippel-Lindau disease tumor suppressor
14	9606.ENSP00000318635	0.966	Small ubiquitin-related modifier 4
15	9606.ENSP00000278616	0.954	Serine-protein kinase ATM
16	9606.ENSP00000411532	0.951	DNA topoisomerase 2-alpha
17	9606.ENSP00000447173	0.939	Vitamin D3 receptor
18	9606.ENSP00000344479	0.934	Nuclear receptor subfamily 4 group A member 2
19	9606.ENSP00000262158	0.920	Mothers against decapentaplegic homolog 7
20	9606.ENSP00000320898	0.920	E3 ubiquitin-protein ligase RNF168

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031625	0.998	ubiquitin protein ligase binding
GO:0061665	0.997	SUMO ligase activity
GO:0003677	0.793	DNA binding
GO:0140110	0.724	transcription regulator activity
GO:0008134	0.701	transcription factor binding
GO:0140297	0.622	DNA-binding transcription factor binding
GO:0003712	0.303	transcription coregulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0080090	0.985	regulation of primary metabolic process
GO:0050896	0.983	response to stimulus
GO:2001141	0.982	regulation of RNA biosynthetic process
GO:0006807	0.978	nitrogen compound metabolic process
GO:0048518	0.975	positive regulation of biological process
GO:0043170	0.966	macromolecule metabolic process
GO:1903506	0.961	regulation of nucleic acid-templated transcription
GO:0048583	0.960	regulation of response to stimulus
GO:0009893	0.955	positive regulation of metabolic process
GO:0048519	0.952	negative regulation of biological process
GO:0010604	0.950	positive regulation of macromolecule metabolic process
GO:0051716	0.927	cellular response to stimulus
GO:0048522	0.926	positive regulation of cellular process
GO:0010468	0.924	regulation of gene expression
GO:0006355	0.912	regulation of DNA-templated transcription
GO:0048523	0.909	negative regulation of cellular process
GO:0032446	0.895	protein modification by small protein conjugation
GO:0048584	0.853	positive regulation of response to stimulus
GO:2001020	0.850	regulation of response to DNA damage stimulus
GO:0051173	0.850	positive regulation of nitrogen compound metabolic process
GO:0010605	0.831	negative regulation of macromolecule metabolic process
GO:0018193	0.826	peptidyl-amino acid modification
GO:0044237	0.816	cellular metabolic process
GO:0031324	0.812	negative regulation of cellular metabolic process
GO:0018205	0.808	peptidyl-lysine modification
GO:2001022	0.789	positive regulation of response to DNA damage stimulus
GO:0016925	0.782	protein sumoylation
GO:0051172	0.767	negative regulation of nitrogen compound metabolic process
GO:0023051	0.727	regulation of signaling
GO:0010646	0.650	regulation of cell communication
GO:0046483	0.646	heterocycle metabolic process
GO:1901360	0.645	organic cyclic compound metabolic process
GO:0009966	0.642	regulation of signal transduction
GO:0031325	0.640	positive regulation of cellular metabolic process
GO:0006950	0.633	response to stress
GO:0090304	0.630	nucleic acid metabolic process
GO:0045934	0.619	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.577	negative regulation of biosynthetic process
GO:0032502	0.567	developmental process
GO:0045935	0.566	positive regulation of nucleobase-containing compound metabolic process
GO:0031327	0.563	negative regulation of cellular biosynthetic process
GO:0033554	0.545	cellular response to stress
GO:0006974	0.536	cellular response to DNA damage stimulus
GO:0032501	0.495	multicellular organismal process
GO:0006281	0.485	DNA repair
GO:0010941	0.471	regulation of cell death
GO:0010558	0.460	negative regulation of macromolecule biosynthetic process
GO:0051246	0.446	regulation of protein metabolic process
GO:0042981	0.445	regulation of apoptotic process
GO:0006357	0.445	regulation of transcription by RNA polymerase II
GO:0051247	0.431	positive regulation of protein metabolic process
GO:0051253	0.412	negative regulation of RNA metabolic process
GO:0045892	0.389	negative regulation of DNA-templated transcription
GO:0031328	0.370	positive regulation of cellular biosynthetic process
GO:0010557	0.362	positive regulation of macromolecule biosynthetic process
GO:0065009	0.336	regulation of molecular function
GO:0048585	0.334	negative regulation of response to stimulus
GO:1902680	0.329	positive regulation of RNA biosynthetic process
GO:0031399	0.318	regulation of protein modification process
GO:0006302	0.318	double-strand break repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.975	cytoplasm
GO:0032991	0.893	protein-containing complex
GO:0005829	0.544	cytosol
GO:1902494	0.482	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]