StarFunc result for job id Q8N2X6

User Input

>input (119 residues)
MPAVFMLASSSALQCGRGVPRFPRTEVGAGHSVNEETKAEKVGNQTSVIPATSRQAALGT
SWTQRRTQPLQERSHWHPRGNNASGMGGHRMFPGPLRGPAAQVLENECGSLGRAAEGRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2X6	1.000	1.000	4.733E-17	119	1.000	1.000	Q8N2X6.pdb.gz	EXAS1_HUMAN Uncharacterized protein EXOC3-AS1 OS=Homo sapiens OX=9606 GN=EXOC3-AS1 PE=1 SV=1
2	AFDB:B3DGY1	0.162	0.046	1.062	520	0.109	0.025	B3DGY1.pdb.gz
3	AFDB:Q9PTD5	0.144	0.067	1.732	335	0.193	0.069	Q9PTD5.pdb.gz	MTFR1_CHICK Mitochondrial fission regulator 1 OS=Gallus gallus OX=9031 GN=MTFR1 PE=1 SV=2
4	AFDB:Q8VYP9	0.173	0.058	3.247	476	0.118	0.029	Q8VYP9.pdb.gz	ICML1_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL1 OS=Arabidopsis thaliana OX=3702 GN=ICMEL1 PE=2 SV=1
5	AFDB:Q9ZQ33	0.153	0.074	5.295	322	0.168	0.062	Q9ZQ33.pdb.gz	Q9ZQ33_ARATH Sequence-specific DNA binding transcription factor OS=Arabidopsis thaliana OX=3702 GN=At2g24340 PE=4 SV=1
6	AFDB:E7EV13	0.167	0.056	5.678	500	0.176	0.042	E7EV13.pdb.gz	E7EV13_HUMAN Amino acid transporter OS=Homo sapiens OX=9606 GN=SLC1A6 PE=1 SV=2
7	AFDB:Q9P2C4	0.198	0.058	6.089	612	0.185	0.036	Q9P2C4.pdb.gz	TM181_HUMAN Transmembrane protein 181 OS=Homo sapiens OX=9606 GN=TMEM181 PE=1 SV=2
8	AFDB:E3VNM4	0.211	0.078	7.002	460	0.134	0.035	E3VNM4.pdb.gz	TGA10_ARATH Transcription factor TGA10 OS=Arabidopsis thaliana OX=3702 GN=TGA10 PE=1 SV=1
9	AFDB:F1QGF1	0.144	0.026	7.002	1111	0.126	0.014	F1QGF1.pdb.gz	F1QGF1_DANRE Uncharacterized protein LOC503753 OS=Danio rerio OX=7955 GN=zgc:113263 PE=1 SV=3
10	AFDB:P32490	0.191	0.062	8.052	508	0.134	0.031	P32490.pdb.gz	MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MKK1 PE=1 SV=1
11	PDB:3j6b3	0.139	0.134	8.426	126	0.151	0.143	3j6b3.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
12	PDB:6xt9J	0.176	0.358	8.426	55	0.067	0.145	6xt9J.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N2X6	1.17e-83	241	119	1.000	1.000	EXAS1_HUMAN Uncharacterized protein EXOC3-AS1 OS=Homo sapiens OX=9606 GN=EXOC3-AS1 PE=1 SV=1
2	B4DPX9	3.6	29.3	588	0.134	0.027	B4DPX9_HUMAN YTH domain-containing family protein OS=Homo sapiens OX=9606 PE=2 SV=1
3	O74799	4.2	28.9	464	0.134	0.034	EXG3_SCHPO Glucan 1,3-beta-glucosidase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=exg3 PE=3 SV=1
4	Q7Z739	4.2	28.9	585	0.134	0.027	YTHD3_HUMAN YTH domain-containing family protein 3 OS=Homo sapiens OX=9606 GN=YTHDF3 PE=1 SV=1
5	A0A8I6G7Y9	4.3	29.3	2861	0.101	0.004	A0A8I6G7Y9_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
6	Q8BYK6	6.2	28.5	585	0.134	0.027	YTHD3_MOUSE YTH domain-containing family protein 3 OS=Mus musculus OX=10090 GN=Ythdf3 PE=1 SV=2
7	Q9P0L9	8.9	28.1	805	0.227	0.034	PK2L1_HUMAN Polycystin-2-like protein 1 OS=Homo sapiens OX=9606 GN=PKD2L1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1111728.ATYS01000010_gene265

Rank	PPI partner	STRING score	Description
1	1111728.ATYS01000012_gene161	0.999	Participates in initiation and elongation during chromosome replication
2	1111728.ATYS01000010_gene266	0.991	Confers DNA tethering and processivity to DNA polymerases and other proteins. Acts as a clamp, forming a ring around DNA (a reaction catalyzed by the clamp-loading complex) which diffuses in an ATP- independent manner freely and bidirectionally along dsDNA. Initially characterized for its ability to contact the catalytic subunit of DNA polymerase III (Pol III), a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria
3	1111728.ATYS01000010_gene267	0.959	The RecF protein is involved in DNA metabolism
4	1111728.ATYS01000010_gene268	0.938	A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner
5	1111728.ATYS01000013_gene4921	0.819	annotation not available
6	1111728.ATYS01000034_gene20	0.803	In addition to polymerase activity, this DNA polymerase exhibits 5'-3' exonuclease activity
7	1111728.ATYS01000016_gene4649	0.800	The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abnormalities. Upon binding of the UvrA(2)B(2) complex to a putative damaged site, the DNA wraps around one UvrB monomer. DNA wrap is dependent on ATP binding by UvrB and probably causes local melting of the DNA helix, facilitating insertion of UvrB beta-hairpin between the DNA strands. Then UvrB probes one DNA strand for the presence of a lesion. If a lesion is found the UvrA subunits dissociate and the UvrB-DNA preincision [...]
8	1111728.ATYS01000027_gene4413	0.794	NAD-binding protein involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain tRNAs, forming tRNA-cmnm(5)s(2)U34
9	1111728.ATYS01000026_gene4193	0.780	RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication.
10	1111728.ATYS01000017_gene3223	0.767	A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in an underwound state. Negative supercoiling favors strand separation, and DNA replication, transcription, recombination and repair, all of which involve strand separation. Also able to catalyze the interconversion of other topological isomers of dsDNA rings, including catenanes and knotted rings. Type II topoisomerases break and join 2 DNA strands simultaneously in an ATP-dependent manner
11	1111728.ATYS01000020_gene3928	0.765	annotation not available
12	1111728.ATYS01000056_gene3567	0.761	One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It has been suggested to have peptidyltransferase activity
13	1111728.ATYS01000010_gene263	0.749	RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein component plays an auxiliary but essential role in vivo by binding to the 5'-leader sequence and broadening the substrate specificity of the ribozyme.
14	1111728.ATYS01000027_gene4412	0.747	Specifically methylates the N7 position of guanine in position 527 of 16S rRNA
15	1111728.ATYS01000003_gene1881	0.746	Can catalyze the hydrolysis of ATP in the presence of single- stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage
16	1111728.ATYS01000010_gene264	0.734	Belongs to the bacterial ribosomal protein bL34 family.
17	1111728.ATYS01000046_gene3026	0.712	DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity.
18	1111728.ATYS01000008_gene1482	0.675	annotation not available
19	1111728.ATYS01000056_gene3588	0.661	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
20	1111728.ATYS01000027_gene4414	0.659	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.701	multicellular organismal process
GO:0007275	0.533	multicellular organism development
GO:0009987	0.303	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.994	intracellular anatomical structure
GO:0043226	0.832	organelle
GO:0043227	0.742	membrane-bounded organelle
GO:0005737	0.734	cytoplasm
GO:0043229	0.696	intracellular organelle
GO:0043231	0.649	intracellular membrane-bounded organelle
GO:0005634	0.482	nucleus
GO:0070013	0.412	intracellular organelle lumen
GO:0031981	0.374	nuclear lumen
GO:0005654	0.342	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]