StarFunc result for job id Q8N2Y8

User Input

>input (1516 residues)
MDSPPKLTGETLIVHHIPLVHCQVPDRQCCGGAGGGGGSTRPNPFCPPELGITQPDQDLG
QADSLLFSSLHSTPGGTARSIDSTKSRSRDGRGPGAPKRHNPFLLQEGVGEPGLGDLYDD
SIGDSATQQSFHLHGTGQPNFHLSSFQLPPSGPRVGRPWGTTRSRAGVVEGQEQEPVMTL
DTQQCGTSHCCRPELEAETMELDECGGPGGSGSGGGASDTSGFSFDQEWKLSSDESPRNP
GCSGSGDQHCRCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMHGTPRANLN
SAPQSCSDSSFCSHSDPGAFYLDLQPSPFESKMSYESHHPESGGREGGYGCPHASSPELD
ANCNSYRPHCEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAGSSITSC
SEEHTKISPPPGPGPDPGPSQPSEYYLFQKPEVQPEEQEAVSSSTQAAAAVGPTVLEGQV
YTNTSPPNLSTGRQRSRSYDRSLQRSPPVRLGSLERMLSCPVRLSEGPAAMAGPGSPPRR
VTSFAELAKGRKKTGGSGSPPLRVSVGDSSQEFSPIQEAQQDRGAPLDEGTCCSHSLPPM
PLGPGMDLLGPDPSPPWSTQVCQGPHSSEMPPAGLRATGQGPLAQLMDPGPALPGSPANS
HTQRDARARADGGGTESRPVLRYSKEQRPTTLPIQPFVFQHHFPKQLAKARALHSLSQLY
SLSGCSRTQQPAPLAAPAAQVSVPAPSGEPQASTPRATGRGARKAGSEPETSRPSPLGSY
SPIRSVGPFGPSTDSSASTSCSPPPEQPTATESLPPWSHSCPSAVRPATSQQPQKEDQKI
LTLTEYRLHGTGSLPPLGSWRSGLSRAESLARGGGEGSMATRPSNANHLSPQALKWREYR
RKNPLGPPGLSGSLDRRSQEARLARRNPIFEFPGSLSAASHLNCRLNGQAVKPLPLTCPD
FQDPFSLTEKPPAEFCLSPDGSSEAISIDLLQKKGLVKAVNIAVDLIVAHFGTSRDPGVK
AKLGNSSVSPNVGHLVLKYLCPAVRAVLEDGLKAFVLDVIIGQRKNMPWSVVEASTQLGP
STKVLHGLYNKVSQFPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHYQPWG
FLSAAHTVCPGLFEELLLLLQPLALLPFSLDLLFQHRLLQSGQQQRQHKELLRVSQDLLL
SAHSTLQLARARGQEGPGDVDRAAQGERVKGVGASEGGEEEEEEEETEEVAEAAGGSGRA
RWARGGQAGWWYQLMQSSQVYIDGSIEGSRFPRGSSNSSSEKKKGAGGGGPPQAPPPREG
VVEGAEACPASEEALGRERGWPFWMGSPPDSVLAELRRSREREGPAASPAENEEGASEPS
PGGIKWGHLFGSRKAQREARPTNRLPSDWLSLDKSMFQLVAQTVGSRREPEPKESLQEPH
SPALPSSPPCEVQALCHHLATGPGQLSFHKGDILRVLGRAGGDWLRCSRGPDSGLVPLAY
VTLTPTPSPTPGSSQN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2Y8	1.000	1.000	0.000	1516	1.000	1.000	Q8N2Y8.pdb.gz	RUSC2_HUMAN AP-4 complex accessory subunit RUSC2 OS=Homo sapiens OX=9606 GN=RUSC2 PE=1 SV=3
2	AFDB:Q80XI3	0.041	0.040	9.143E-9	1579	0.122	0.117	Q80XI3.pdb.gz	IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus OX=10090 GN=Eif4g3 PE=1 SV=2
3	AFDB:O43432	0.043	0.042	9.664E-9	1585	0.117	0.112	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
4	AFDB:A8DZ29	0.040	0.035	4.558E-8	1919	0.145	0.115	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
5	AFDB:Q76E23	0.051	0.047	8.126E-7	1727	0.138	0.121	Q76E23.pdb.gz	IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana OX=3702 GN=EIF4G PE=1 SV=2
6	AFDB:D3ZRA6	0.035	0.033	6.310E-6	1683	0.152	0.137	D3ZRA6.pdb.gz	D3ZRA6_RAT Trinucleotide repeat containing adaptor 6C OS=Rattus norvegicus OX=10116 GN=Tnrc6c PE=1 SV=4
7	AFDB:X2JEI9	0.057	0.044	1.039E-5	2206	0.172	0.118	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
8	AFDB:O14029	0.038	0.033	2.020E-5	1995	0.191	0.145	O14029.pdb.gz	SEC16_SCHPO COPII coat assembly protein sec16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec16 PE=1 SV=2
9	AFDB:Q9NZM4	0.039	0.038	4.387E-5	1560	0.185	0.180	Q9NZM4.pdb.gz	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
10	AFDB:A0A5F8MPU3	0.038	0.029	9.014E-5	2282	0.149	0.099	A0A5F8MPU3.pdb.gz	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
11	PDB:1griA	0.041	0.284	3.397E-4	211	0.011	0.081	1griA.pdb.gz
12	PDB:2dybA	0.035	0.176	5.593E-4	298	0.010	0.050	2dybA.pdb.gz
13	PDB:1k9aB	0.036	0.123	1.029E-3	441	0.010	0.034	1k9aB.pdb.gz
14	PDB:3qwyA	0.042	0.320	1.215E-3	170	0.012	0.106	3qwyA.pdb.gz
15	PDB:2lqnA	0.041	0.191	1.516E-3	303	0.013	0.063	2lqnA.pdb.gz
16	PDB:2h8hA	0.035	0.117	2.234E-3	445	0.011	0.038	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
17	PDB:3ehqA	0.038	0.294	3.480E-3	182	0.008	0.066	3ehqA.pdb.gz
18	PDB:1k0xA	0.038	0.471	9.971E-3	108	0.009	0.130	1k0xA.pdb.gz
19	PDB:2eyzA	0.043	0.183	1.054E-2	304	0.014	0.069	2eyzA.pdb.gz
20	PDB:6x5hA	0.037	0.120	1.553E-2	467	0.007	0.024	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N2Y8	0.0	3053	1516	1.000	1.000	RUSC2_HUMAN AP-4 complex accessory subunit RUSC2 OS=Homo sapiens OX=9606 GN=RUSC2 PE=1 SV=3
2	Q8BG26	4.24e-63	235	893	0.125	0.213	RUSC1_MOUSE AP-4 complex accessory subunit RUSC1 OS=Mus musculus OX=10090 GN=Rusc1 PE=1 SV=2
3	Q9BVN2	3.78e-46	183	902	0.067	0.112	RUSC1_HUMAN AP-4 complex accessory subunit RUSC1 OS=Homo sapiens OX=9606 GN=RUSC1 PE=1 SV=3
4	Q68CX2	3.41e-14	75.5	211	0.048	0.346	Q68CX2_HUMAN RUN and SH3 domain containing 1 OS=Homo sapiens OX=9606 GN=RUSC1 PE=1 SV=2
5	A0A087WZ68	6.95e-11	63.5	127	0.033	0.394	A0A087WZ68_HUMAN RUN and SH3 domain containing 1 OS=Homo sapiens OX=9606 GN=RUSC1 PE=1 SV=1
6	G5ECQ1	3.36e-05	50.8	665	0.023	0.053	G5ECQ1_CAEEL RUN domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-14 PE=1 SV=1
7	O74749	6.50e-04	46.2	373	0.024	0.097	HSE1_SCHPO Class E vacuolar protein-sorting machinery protein hse1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hse1 PE=3 SV=1
8	F8W7U0	0.002	45.4	1149	0.016	0.021	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1
9	Q15811	0.002	45.1	1721	0.016	0.014	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
10	Q9NZM3	0.002	45.4	1697	0.013	0.012	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
11	O43281	0.003	44.7	561	0.018	0.050	EFS_HUMAN Embryonal Fyn-associated substrate OS=Homo sapiens OX=9606 GN=EFS PE=1 SV=1
12	P38753	0.003	44.3	452	0.013	0.044	HSE1_YEAST Class E vacuolar protein-sorting machinery protein HSE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HSE1 PE=1 SV=1
13	Q64355	0.003	44.7	560	0.018	0.048	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
14	E7EQN5	0.004	44.3	925	0.019	0.031	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
15	P98171	0.004	44.3	946	0.019	0.031	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
16	E9PCM6	0.005	43.9	768	0.019	0.038	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
17	Q13588	0.005	42.4	217	0.027	0.189	GRAP_HUMAN GRB2-related adapter protein OS=Homo sapiens OX=9606 GN=GRAP PE=1 SV=1
18	Q9Z0R6	0.005	44.3	1659	0.012	0.011	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
19	A3FG33	0.007	43.9	2480	0.015	0.009	A3FG33_DANRE Alpha II-spectrin OS=Danio rerio OX=7955 GN=wu:fa20e05 PE=2 SV=1
20	H0YKF1	0.007	40.4	133	0.013	0.150	H0YKF1_HUMAN Proline-serine-threonine phosphatase interacting protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSTPIP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02759 RUN	3.2e-16	71.1	RUN domain
2	PF00018 SH3_1	0.29	22.1	SH3 domain
3	PF07653 SH3_2	0.0015	29.6	Variant SH3 domain
4	PF14604 SH3_9	0.0024	29.1	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393922

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229340	0.961	Ras-related protein Rab-35
2	9606.ENSP00000310226	0.873	Ras-related protein Rab-1B
3	9606.ENSP00000387286	0.845	Ras-related protein Rab-1A
4	9606.ENSP00000416097	0.794	Golgin subfamily A member 2
5	9606.ENSP00000300714	0.764	AP-4 complex accessory subunit Tepsin
6	9606.ENSP00000481045	0.748	Dual specificity testis-specific protein kinase 1
7	9606.ENSP00000261842	0.715	AP-4 complex subunit epsilon-1
8	9606.ENSP00000324287	0.710	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2
9	9606.ENSP00000216366	0.693	AP-4 complex subunit sigma-1
10	9606.ENSP00000342962	0.647	Serine incorporator 1
11	9606.ENSP00000352603	0.628	AP-4 complex subunit mu-1
12	9606.ENSP00000362727	0.586	DENN domain-containing protein 1A
13	9606.ENSP00000351664	0.563	[F-actin]-monooxygenase MICAL1
14	9606.ENSP00000347464	0.550	ARF GTPase-activating protein GIT2
15	9606.ENSP00000222145	0.548	Ras-interacting protein 1
16	9606.ENSP00000391524	0.535	Protein DENND6B
17	9606.ENSP00000386710	0.527	Autophagy-related protein 9A
18	9606.ENSP00000373713	0.521	Phosphatidylinositide phosphatase SAC1
19	9606.ENSP00000373420	0.516	RUN and FYVE domain containing 2
20	9606.ENSP00000361731	0.513	TBC1 domain family member 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.965	cellular process
GO:0065007	0.715	biological regulation
GO:0050789	0.644	regulation of biological process
GO:0050794	0.575	regulation of cellular process
GO:0051179	0.443	localization
GO:0051234	0.364	establishment of localization
GO:0051641	0.355	cellular localization
GO:0006810	0.310	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031410	0.998	cytoplasmic vesicle
GO:0070062	0.997	extracellular exosome
GO:0012505	0.937	endomembrane system
GO:0016020	0.872	membrane
GO:0031090	0.835	organelle membrane
GO:0005829	0.559	cytosol
GO:0005634	0.541	nucleus
GO:0070013	0.322	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]