StarFunc result for job id Q8N328

User Input

>input (593 residues)
MPRTLSLHEITDLLETDDSIEASAIVIQPPENATAPVSDEESGDEEGGTINNLPGSLLHT
AAYLIQDGSDAESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT
VQPVAGRVTAPPNDFFTVMRTPTEILELFLDDEVIELIVKYSNLYACSKGVHLGLTSSEF
KCFLGIIFLSGYVSVPRRRMFWEQRTDVHNVLVSAAMRRDRFETIFSNLHVADNANLDPV
DKFSKLRPLISKLNERCMKFVPNETYFSFDEFMVPYFGRHGCKQFIRGKPIRFGYKFWCG
ATCLGYICWFQPYQGKNPNTKHEEYGVGASLVLQFSEALTEAHPGQYHFVFNNFFTSIAL
LDKLSSMGHQATGTVRKDHIDRVPLESDVALKKKERGTFDYRIDGKGNIVCRWNDNSVVT
VASSGAGIHPLCLVSRYSQKLKKKIQVQQPNMIKVYNQFMGGVDRADENIDKYRASIRGK
KWYSSPLLFCFELVLQNAWQLHKTYDEKPVDFLEFRRRVVCHYLETHGHPPEPGQKGRPQ
KRNIDSRYDGINHVIVKQGKQTRCAECHKNTTFRCEKCDVALHVKCSVEYHTE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DP91	0.932	0.525	0.000	1061	1.000	0.559	P0DP91.pdb.gz	ERPG3_HUMAN Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
2	AFDB:Q96JS3	0.675	0.498	2.142E-46	809	0.300	0.220	Q96JS3.pdb.gz	PGBD1_HUMAN PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1
3	AFDB:Q8N414	0.549	0.614	1.062E-20	524	0.150	0.170	Q8N414.pdb.gz	PGBD5_HUMAN PiggyBac transposable element-derived protein 5 OS=Homo sapiens OX=9606 GN=PGBD5 PE=1 SV=4
4	PDB:6oonA	0.126	0.104	1.229E-2	785	0.049	0.037	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
5	PDB:5guhA	0.141	0.118	1.297E-2	759	0.064	0.050	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
6	AFDB:Q9XVI3	0.138	0.104	1.931E-2	905	0.051	0.033	Q9XVI3.pdb.gz	Q9XVI3_CAEEL Protein argonaute-2 OS=Caenorhabditis elegans OX=6239 GN=alg-5 PE=3 SV=2
7	AFDB:Q69Z66	0.097	0.079	2.039E-2	819	0.113	0.082	Q69Z66.pdb.gz	MYSM1_MOUSE Deubiquitinase MYSM1 OS=Mus musculus OX=10090 GN=Mysm1 PE=1 SV=2
8	AFDB:Q9LJL8	0.204	0.256	2.822E-2	446	0.083	0.110	Q9LJL8.pdb.gz	Q9LJL8_ARATH AT3g19120/MVI11_3 OS=Arabidopsis thaliana OX=3702 GN=At3g19120 PE=1 SV=1
9	AFDB:Q96MB7	0.222	0.340	2.979E-2	349	0.064	0.109	Q96MB7.pdb.gz	HARB1_HUMAN Putative nuclease HARBI1 OS=Homo sapiens OX=9606 GN=HARBI1 PE=1 SV=1
10	PDB:4krfA	0.130	0.103	3.087E-2	817	0.047	0.034	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
11	PDB:7nvnZ	0.080	0.088	5.306E-2	529	0.078	0.087	7nvnZ.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
12	PDB:5weaA	0.134	0.110	6.590E-2	764	0.047	0.037	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
13	PDB:5c2lA	0.080	0.113	7.345E-2	349	0.044	0.074	5c2lA.pdb.gz	Binding and mimicking of the phosphate-rich substrate, PRPP
14	AFDB:Q5JSP0	0.079	0.071	1.093E-1	725	0.143	0.117	Q5JSP0.pdb.gz	FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FGD3 PE=1 SV=1
15	PDB:4xcdA	0.079	0.089	1.748E-1	507	0.067	0.079	4xcdA.pdb.gz	Structural and Functional Insights into the Evolution and Stress Adaptation of Type II Chaperonins.
16	PDB:5vm9C	0.131	0.106	1.845E-1	785	0.044	0.033	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
17	PDB:1jcfA	0.102	0.166	1.948E-1	336	0.052	0.092	1jcfA.pdb.gz
18	AFDB:O88842	0.087	0.079	2.334E-1	733	0.148	0.120	O88842.pdb.gz	FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fgd3 PE=1 SV=1
19	AFDB:Q06488	0.073	0.054	3.061E-1	889	0.074	0.049	Q06488.pdb.gz	RSC2_YEAST Chromatin structure-remodeling complex subunit RSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSC2 PE=1 SV=1
20	PDB:7by6B	0.064	0.063	5.165E-1	606	0.025	0.025	7by6B.pdb.gz	Structural basis of malaria parasite phenylalanine tRNA-synthetase inhibition by bicyclic azetidines.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DP91	0.0	1261	1061	1.000	0.559	ERPG3_HUMAN Chimeric ERCC6-PGBD3 protein OS=Homo sapiens OX=9606 GN=ERCC6 PE=1 SV=1
2	Q8N328	0.0	1245	593	1.000	1.000	PGBD3_HUMAN PiggyBac transposable element-derived protein 3 OS=Homo sapiens OX=9606 GN=PGBD3 PE=1 SV=3
3	Q96JS3	7.30e-105	336	809	0.285	0.209	PGBD1_HUMAN PiggyBac transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=PGBD1 PE=1 SV=1
4	Q8N414	1.23e-07	57.0	524	0.126	0.143	PGBD5_HUMAN PiggyBac transposable element-derived protein 5 OS=Homo sapiens OX=9606 GN=PGBD5 PE=1 SV=4
5	D3YZI9	3.49e-06	52.4	523	0.135	0.153	PGBD5_MOUSE PiggyBac transposable element-derived protein 5 OS=Mus musculus OX=10090 GN=Pgbd5 PE=1 SV=1
6	Q0WL80	2.8	33.5	1613	0.025	0.009	UGGG_ARATH UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
7	Q9ZR86	3.0	33.1	569	0.032	0.033	Q9ZR86_MAIZE PDI-like protein OS=Zea mays OX=4577 PE=2 SV=1
8	O65418	3.4	33.1	777	0.037	0.028	APC4_ARATH Anaphase-promoting complex subunit 4 OS=Arabidopsis thaliana OX=3702 GN=APC4 PE=2 SV=2
9	P0AEY8	3.9	32.7	410	0.030	0.044	MDFA_ECOLI Multidrug transporter MdfA OS=Escherichia coli (strain K12) OX=83333 GN=mdfA PE=1 SV=1
10	Q12706	5.4	32.3	436	0.030	0.041	PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psk1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03107 C1_2	71	15.2	C1 domain
2	PF13843 DDE_Tnp_1_7	5.2e-99	343.5	Transposase IS4
3	PF00643 zf-B_box	2.4e+02	13.3	B-box zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000423550

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265038	0.941	DNA excision repair protein ERCC-8
2	9606.ENSP00000375809	0.880	TFIIH basal transcription factor complex helicase XPD subunit
3	9606.ENSP00000310520	0.866	DNA repair endonuclease XPF
4	9606.ENSP00000347978	0.860	DNA repair protein complementing XP-G cells
5	9606.ENSP00000364270	0.842	DNA repair protein complementing XP-A cells
6	9606.ENSP00000285398	0.832	TFIIH basal transcription factor complex helicase XPB subunit
7	9606.ENSP00000374501	0.824	UV-stimulated scaffold protein A
8	9606.ENSP00000221859	0.820	DNA-directed RNA polymerase II subunit RPB9
9	9606.ENSP00000013807	0.812	DNA excision repair protein ERCC-1
10	9606.ENSP00000348089	0.802	DNA excision repair protein ERCC-6
11	9606.ENSP00000272645	0.793	DNA-directed RNA polymerase II subunit RPB4
12	9606.ENSP00000350708	0.788	UV excision repair protein RAD23 homolog B
13	9606.ENSP00000265990	0.783	TATA-binding protein-associated factor 172
14	9606.ENSP00000370625	0.779	DNA-directed RNA polymerase II subunit RPB2
15	9606.ENSP00000480158	0.776	DNA-directed RNA polymerase II subunit RPB1
16	9606.ENSP00000307208	0.736	Nucleosome-remodeling factor subunit BPTF
17	9606.ENSP00000267430	0.726	Fanconi anemia group M protein
18	9606.ENSP00000219252	0.697	DNA-directed RNA polymerase II subunit RPB3
19	9606.ENSP00000269305	0.695	Cellular tumor antigen p53
20	9606.ENSP00000301788	0.690	DNA-directed RNA polymerase II subunit RPB7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043565	1.000	sequence-specific DNA binding
GO:0003824	0.590	catalytic activity
GO:0005515	0.537	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006807	0.927	nitrogen compound metabolic process
GO:0050794	0.918	regulation of cellular process
GO:0009987	0.893	cellular process
GO:0071704	0.810	organic substance metabolic process
GO:0044238	0.804	primary metabolic process
GO:0044237	0.777	cellular metabolic process
GO:0043170	0.752	macromolecule metabolic process
GO:0048518	0.673	positive regulation of biological process
GO:0051171	0.670	regulation of nitrogen compound metabolic process
GO:0090304	0.667	nucleic acid metabolic process
GO:0019219	0.662	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.661	regulation of macromolecule metabolic process
GO:0044260	0.655	cellular macromolecule metabolic process
GO:0006259	0.619	DNA metabolic process
GO:0048522	0.428	positive regulation of cellular process
GO:0050896	0.390	response to stimulus
GO:0051173	0.383	positive regulation of nitrogen compound metabolic process
GO:0010604	0.376	positive regulation of macromolecule metabolic process
GO:0031325	0.365	positive regulation of cellular metabolic process
GO:0048583	0.347	regulation of response to stimulus
GO:0080134	0.344	regulation of response to stress
GO:0051052	0.344	regulation of DNA metabolic process
GO:0006950	0.341	response to stress
GO:0045935	0.309	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0016604	0.794	nuclear body
GO:0005737	0.328	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]