StarFunc result for job id Q8N335

User Input

>input (351 residues)
MAAAPLKVCIVGSGNWGSAVAKIIGNNVKKLQKFASTVKMWVFEETVNGRKLTDIINNDH
ENVKYLPGHKLPENVVAMSNLSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITL
IKGIDEGPEGLKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFK
ELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVIRLGLMEMIAF
ARIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFARTGKTIEELEKEMLNGQKLQ
GPQTSAEVYRILKQKGLLDKFPLFTAVYQICYESRPVQEMLSCLQSHPEHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3ULJ0	0.999	0.999	1.730E-60	351	0.952	0.952	Q3ULJ0.pdb.gz	GPD1L_MOUSE Glycerol-3-phosphate dehydrogenase 1-like protein OS=Mus musculus OX=10090 GN=Gpd1l PE=1 SV=2
2	PDB:2plaA	0.963	0.985	2.035E-56	343	0.974	0.997	2plaA.pdb.gz	Crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein.
3	AFDB:O35077	0.989	0.995	9.705E-53	349	0.721	0.725	O35077.pdb.gz	GPDA_RAT Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Rattus norvegicus OX=10116 GN=Gpd1 PE=1 SV=4
4	PDB:1x0xA	0.983	0.986	3.103E-48	350	0.709	0.711	1x0xA.pdb.gz	Crystal Structures of Human Glycerol 3-phosphate Dehydrogenase 1 (GPD1)
5	AFDB:P13706	0.939	0.909	8.569E-46	363	0.607	0.587	P13706.pdb.gz	GPDA_DROME Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Gpdh1 PE=1 SV=3
6	AFDB:P34517	0.974	0.873	1.900E-44	392	0.578	0.518	P34517.pdb.gz	GPDH2_CAEEL Probable glycerol-3-phosphate dehydrogenase 2 OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=3 SV=2
7	AFDB:P21696	0.898	0.823	7.592E-40	385	0.499	0.455	P21696.pdb.gz	GPD1_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd1 PE=1 SV=2
8	AFDB:Q09845	0.874	0.825	4.366E-39	373	0.479	0.450	Q09845.pdb.gz	GPD2_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd2 PE=1 SV=1
9	AFDB:Q00055	0.890	0.804	5.072E-39	391	0.459	0.412	Q00055.pdb.gz	GPD1_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPD1 PE=1 SV=4
10	AFDB:Q6FWJ7	0.885	0.745	1.677E-37	422	0.450	0.374	Q6FWJ7.pdb.gz	GPD2_CANGA Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GPD2 PE=3 SV=1
11	AFDB:Q59W33	0.876	0.832	3.732E-37	371	0.467	0.442	Q59W33.pdb.gz	GPD2_CANAL Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPD2 PE=1 SV=1
12	AFDB:P41911	0.897	0.725	4.335E-37	440	0.433	0.345	P41911.pdb.gz	GPD2_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPD2 PE=1 SV=2
13	PDB:4fgwA	0.843	0.838	4.206E-35	353	0.459	0.456	4fgwA.pdb.gz
14	PDB:6xp1B	0.405	0.491	7.704E-8	281	0.142	0.178	6xp1B.pdb.gz	In crystallo screening for proline analog inhibitors of the proline cycle enzyme PYCR1.
15	PDB:2ofpB	0.498	0.578	9.408E-8	294	0.114	0.136	2ofpB.pdb.gz	Crystal Structure of Escherichia coli Ketopantoate Reductase in a Ternary Complex with NADP+ and Pantoate Bound: SUBSTRATE RECOGNITION, CONFORMATIONAL CHANGE, AND COOPERATIVITY.
16	PDB:4ol9A	0.523	0.602	1.630E-7	297	0.105	0.125	4ol9A.pdb.gz	Crystal Structure of putative 2-dehydropantoate 2-reductase PanE from Mycobacterium tuberculosis complexed with NADP and oxamate
17	PDB:6hcyC	0.331	0.273	2.093E-7	436	0.125	0.101	6hcyC.pdb.gz	Cryo-EM structures of human STEAP4 reveal mechanism of iron(III) reduction.
18	PDB:7kwsA	0.457	0.418	3.282E-7	390	0.165	0.149	7kwsA.pdb.gz	Functional and Structural Characterization of the UDP-Glucose Dehydrogenase Involved in Capsular Polysaccharide Biosynthesis from Campylobacter jejuni .
19	PDB:4ypoA	0.367	0.391	4.430E-7	325	0.125	0.135	4ypoA.pdb.gz	Crystal structure of Mycobacterium tuberculosis ketol-acid reductoisomerase at 1.0 angstrom resolution - a potential target for anti-tuberculosis drug discovery.
20	PDB:3ckyA	0.446	0.510	5.147E-7	297	0.120	0.141	3ckyA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O35077	0.0	536	349	0.718	0.722	GPDA_RAT Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Rattus norvegicus OX=10116 GN=Gpd1 PE=1 SV=4
2	P13707	0.0	535	349	0.712	0.716	GPDA_MOUSE Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Mus musculus OX=10090 GN=Gpd1 PE=1 SV=3
3	P21695	0.0	535	349	0.709	0.713	GPDA_HUMAN Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Homo sapiens OX=9606 GN=GPD1 PE=1 SV=4
4	Q3ULJ0	0.0	694	351	0.952	0.952	GPD1L_MOUSE Glycerol-3-phosphate dehydrogenase 1-like protein OS=Mus musculus OX=10090 GN=Gpd1l PE=1 SV=2
5	Q8N335	0.0	723	351	1.000	1.000	GPD1L_HUMAN Glycerol-3-phosphate dehydrogenase 1-like protein OS=Homo sapiens OX=9606 GN=GPD1L PE=1 SV=1
6	Q7JMU1	6.73e-144	413	371	0.578	0.547	Q7JMU1_CAEEL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=1 SV=1
7	P13706	2.26e-143	412	363	0.604	0.584	GPDA_DROME Glycerol-3-phosphate dehydrogenase [NAD(+)], cytoplasmic OS=Drosophila melanogaster OX=7227 GN=Gpdh1 PE=1 SV=3
8	A7LPE6	1.52e-142	409	360	0.581	0.567	A7LPE6_CAEEL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=1 SV=1
9	P34517	1.86e-142	410	392	0.581	0.520	GPDH2_CAEEL Probable glycerol-3-phosphate dehydrogenase 2 OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=3 SV=2
10	A7LPE5	3.48e-117	343	304	0.521	0.602	A7LPE5_CAEEL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Caenorhabditis elegans OX=6239 GN=gpdh-2 PE=1 SV=1
11	P21696	1.76e-113	337	385	0.499	0.455	GPD1_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd1 PE=1 SV=2
12	Q00055	4.39e-107	320	391	0.456	0.409	GPD1_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPD1 PE=1 SV=4
13	Q09845	3.47e-105	315	373	0.481	0.453	GPD2_SCHPO Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpd2 PE=1 SV=1
14	Q6FWJ7	9.39e-103	310	422	0.447	0.372	GPD2_CANGA Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GPD2 PE=3 SV=1
15	Q59XU9	5.55e-102	308	403	0.442	0.385	Q59XU9_CANAL Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPD1 PE=3 SV=1
16	Q59W33	5.27e-99	299	371	0.473	0.447	GPD2_CANAL Glycerol-3-phosphate dehydrogenase [NAD(+)] 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPD2 PE=1 SV=1
17	P41911	8.35e-96	293	440	0.427	0.341	GPD2_YEAST Glycerol-3-phosphate dehydrogenase [NAD(+)] 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPD2 PE=1 SV=2
18	C8VTT9	4.15e-89	278	485	0.496	0.359	C8VTT9_EMENI Glycerol-3-phosphate dehydrogenase [NAD(+)] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00351 PE=3 SV=1
19	P46919	4.41e-43	154	345	0.319	0.325	GPDA_BACSU Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Bacillus subtilis (strain 168) OX=224308 GN=gpsA PE=3 SV=2
20	Q97NF1	8.77e-40	145	338	0.285	0.296	GPDA_STRPN Glycerol-3-phosphate dehydrogenase [NAD(P)+] OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=gpsA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03807 F420_oxidored	25	17.0	NADP oxidoreductase coenzyme F420-dependent
2	PF20618 GPD_NAD_C_bact	1.1	21.2	Bacterial GPD, NAD-dependent C-terminal
3	PF07479 NAD_Gly3P_dh_C	4.3e-45	164.9	NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
4	PF01210 NAD_Gly3P_dh_N	5.8e-49	177.6	NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282541

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355607	0.936	Glyceronephosphate O-acyltransferase
2	9606.ENSP00000265276	0.925	Glycerol-3-phosphate acyltransferase 1, mitochondrial
3	9606.ENSP00000389395	0.925	Glycerol-3-phosphate acyltransferase 2, mitochondrial
4	9606.ENSP00000380184	0.916	Glycerol-3-phosphate acyltransferase 4
5	9606.ENSP00000482571	0.916	Glycerol-3-phosphate acyltransferase 3
6	9606.ENSP00000378360	0.904	Triokinase/FMN cyclase
7	9606.ENSP00000369099	0.902	Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
8	9606.ENSP00000376523	0.856	Sodium channel subunit beta-3
9	9606.ENSP00000310557	0.831	Potassium voltage-gated channel subfamily E member 3
10	9606.ENSP00000301149	0.828	Glycerol-3-phosphate dehydrogenase 1
11	9606.ENSP00000410257	0.827	Sodium channel protein type 5 subunit alpha
12	9606.ENSP00000308610	0.826	Glycerol-3-phosphate dehydrogenase, mitochondrial
13	9606.ENSP00000381302	0.808	Phospholipid phosphatase 4
14	9606.ENSP00000392553	0.808	Phospholipid phosphatase 5
15	9606.ENSP00000396915	0.802	Sodium channel subunit beta-1
16	9606.ENSP00000226105	0.789	Ran guanine nucleotide release factor
17	9606.ENSP00000295951	0.755	Sarcolemmal membrane-associated protein
18	9606.ENSP00000216254	0.738	Aconitate hydratase, mitochondrial
19	9606.ENSP00000359682	0.720	Bombesin receptor subtype-3
20	9606.ENSP00000349320	0.708	Voltage-dependent calcium channel subunit alpha-2/delta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.998	binding
GO:0047952	0.998	glycerol-3-phosphate dehydrogenase [NAD(P)+] activity
GO:0005515	0.985	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0019637	0.988	organophosphate metabolic process
GO:0044281	0.986	small molecule metabolic process
GO:0044238	0.982	primary metabolic process
GO:0072524	0.976	pyridine-containing compound metabolic process
GO:0006796	0.956	phosphate-containing compound metabolic process
GO:0019362	0.949	pyridine nucleotide metabolic process
GO:0046496	0.944	nicotinamide nucleotide metabolic process
GO:0019674	0.932	NAD metabolic process
GO:0065007	0.507	biological regulation
GO:0050789	0.405	regulation of biological process
GO:0050794	0.340	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.997	membrane
GO:0005829	0.994	cytosol
GO:0005886	0.979	plasma membrane
GO:0043227	0.978	membrane-bounded organelle
GO:0005576	0.950	extracellular region
GO:0005615	0.836	extracellular space
GO:0043231	0.816	intracellular membrane-bounded organelle
GO:0031982	0.812	vesicle
GO:0070062	0.774	extracellular exosome
GO:0070013	0.373	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.94	0.998	glycerol-3-phosphate dehydrogenase [NAD(P)(+)].
EC:1.1.1.8	0.998	glycerol-3-phosphate dehydrogenase (NAD(+)).

[back to server]