StarFunc result for job id Q8N357

User Input

>input (371 residues)
MAWTKYQLFLAGLMLVTGSINTLSAKWADNFMAEGCGGSKEHSFQHPFLQAVGMFLGEFS
CLAAFYLLRCRAAGQSDSSVDPQQPFNPLLFLPPALCDMTGTSLMYVALNMTSASSFQML
RGAVIIFTGLFSVAFLGRRLVLSQWLGILATIAGLVVVGLADLLSKHDSQHKLSEVITGD
LLIIMAQIIVAIQMVLEEKFVYKHNVHPLRAVGTEGLFGFVILSLLLVPMYYIPAGSFSG
NPRGTLEDALDAFCQVGQQPLIAVALLGNISSIAFFNFAGISVTKELSATTRMVLDSLRT
VVIWALSLALGWEAFHALQILGFLILLIGTALYNGLHRPLLGRLSRGRPLAEESEQERLL
GGTRTPINDAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N357	1.000	1.000	1.914E-49	371	1.000	1.000	Q8N357.pdb.gz	S35F6_HUMAN Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1
2	AFDB:Q8VE96	0.938	0.936	1.238E-44	372	0.871	0.868	Q8VE96.pdb.gz	S35F6_MOUSE Solute carrier family 35 member F6 OS=Mus musculus OX=10090 GN=Slc35f6 PE=1 SV=1
3	AFDB:Q9VGF5	0.831	0.811	2.501E-21	381	0.329	0.320	Q9VGF5.pdb.gz	Q9VGF5_DROME LP09696p OS=Drosophila melanogaster OX=7227 GN=Tango9 PE=1 SV=1
4	AFDB:Q9BHL2	0.682	0.740	3.435E-10	340	0.148	0.162	Q9BHL2.pdb.gz	Q9BHL2_CAEEL UAA transporter OS=Caenorhabditis elegans OX=6239 GN=hut-1 PE=1 SV=1
5	AFDB:Q12520	0.706	0.767	7.148E-10	339	0.105	0.115	Q12520.pdb.gz	HUT1_YEAST UDP-galactose transporter homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HUT1 PE=1 SV=1
6	AFDB:Q9GSB0	0.617	0.501	7.148E-10	473	0.205	0.161	Q9GSB0.pdb.gz	CRTP1_DICDI Crt homolog 1 OS=Dictyostelium discoideum OX=44689 GN=crtp1 PE=2 SV=1
7	AFDB:Q9W429	0.661	0.692	7.462E-10	352	0.173	0.182	Q9W429.pdb.gz	S35B4_DROME UDP-xylose and UDP-N-acetylglucosamine transporter OS=Drosophila melanogaster OX=7227 GN=Efr PE=2 SV=1
8	AFDB:B4DE15	0.681	0.627	1.100E-9	406	0.189	0.172	B4DE15.pdb.gz	B4DE15_HUMAN Solute carrier family 35 member A2 OS=Homo sapiens OX=9606 GN=SLC35A2 PE=1 SV=1
9	AFDB:Q8CIA5	0.675	0.750	1.148E-9	331	0.137	0.154	Q8CIA5.pdb.gz	S35B4_MOUSE Nucleotide sugar transporter SLC35B4 OS=Mus musculus OX=10090 GN=Slc35b4 PE=2 SV=2
10	AFDB:P87041	0.710	0.743	1.693E-9	353	0.162	0.170	P87041.pdb.gz	GMS1_SCHPO UDP-galactose transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gms1 PE=2 SV=3
11	PDB:6xboA	0.521	0.590	8.121E-7	319	0.154	0.179	6xboA.pdb.gz	Inhibition of CMP-sialic acid transport by endogenous 5-methyl CMP.
12	PDB:5ogeG	0.556	0.654	3.168E-5	306	0.124	0.150	5ogeG.pdb.gz
13	PDB:7s1xB	0.144	0.091	2.218E-2	871	0.148	0.063	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
14	PDB:7p9uB	0.148	0.128	3.885E-2	455	0.156	0.127	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
15	PDB:7cmhB	0.192	0.169	7.104E-2	458	0.113	0.092	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
16	PDB:3lrbA	0.207	0.194	1.141E-1	410	0.156	0.141	3lrbA.pdb.gz
17	PDB:5oglA	0.119	0.082	1.244E-1	707	0.140	0.074	5oglA.pdb.gz	Molecular basis of lipid-linked oligosaccharide recognition and processing by bacterial oligosaccharyltransferase.
18	PDB:5xezB	0.120	0.096	1.356E-1	499	0.151	0.112	5xezB.pdb.gz	Structure of the full-length glucagon class B G-protein-coupled receptor.
19	PDB:5j4nA	0.160	0.143	1.416E-1	437	0.175	0.149	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
20	PDB:5k3hB	0.163	0.114	1.478E-1	635	0.092	0.054	5k3hB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N357	0.0	749	371	1.000	1.000	S35F6_HUMAN Solute carrier family 35 member F6 OS=Homo sapiens OX=9606 GN=SLC35F6 PE=1 SV=1
2	Q8VE96	0.0	625	372	0.871	0.868	S35F6_MOUSE Solute carrier family 35 member F6 OS=Mus musculus OX=10090 GN=Slc35f6 PE=1 SV=1
3	Q9VGF5	3.64e-58	195	381	0.345	0.336	Q9VGF5_DROME LP09696p OS=Drosophila melanogaster OX=7227 GN=Tango9 PE=1 SV=1
4	Q9W4W6	2.84e-04	44.7	357	0.094	0.098	Q9W4W6_DROME CMP-sialic acid/UDP-galactose transporter OS=Drosophila melanogaster OX=7227 GN=Ugalt PE=1 SV=1
5	O76865	3.63e-04	44.7	368	0.094	0.095	O76865_DROME EG:100G10.5 protein OS=Drosophila melanogaster OX=7227 GN=Ugalt PE=1 SV=1
6	P87041	0.001	43.1	353	0.086	0.091	GMS1_SCHPO UDP-galactose transporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gms1 PE=2 SV=3
7	G5EFD3	0.004	41.2	328	0.073	0.082	G5EFD3_CAEEL Nucleotide sugar transporter OS=Caenorhabditis elegans OX=6239 GN=srf-3 PE=2 SV=1
8	Q93890	0.004	41.2	368	0.073	0.073	SRF3_CAEEL UDP-galactose/UDP-N-acetylglucosamine transporter srf-3 OS=Caenorhabditis elegans OX=6239 GN=srf-3 PE=1 SV=5
9	O59785	0.005	41.2	505	0.102	0.075	YCN8_SCHPO Uncharacterized solute carrier family 35 member C320.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC320.08 PE=1 SV=1
10	Q9Y2D2	0.005	40.8	325	0.078	0.089	S35A3_HUMAN UDP-N-acetylglucosamine transporter OS=Homo sapiens OX=9606 GN=SLC35A3 PE=1 SV=1
11	O77592	0.006	40.4	326	0.067	0.077	S35A3_CANLF UDP-N-acetylglucosamine transporter OS=Canis lupus familiaris OX=9615 GN=SLC35A3 PE=2 SV=1
12	Q5K8Q8	0.021	39.3	703	0.086	0.046	Q5K8Q8_CRYNJ Solute carrier family 35 (UDP-sugar transporter), member A1/2/3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CNL04830 PE=4 SV=2
13	Q5QHQ6	0.030	38.9	561	0.062	0.041	Q5QHQ6_LEIMA LPG5B protein OS=Leishmania major OX=5664 GN=LPG5B PE=4 SV=1
14	Q5T1Q4	0.082	37.4	408	0.181	0.164	S35F1_HUMAN Solute carrier family 35 member F1 OS=Homo sapiens OX=9606 GN=SLC35F1 PE=1 SV=2
15	Q9R0M8	0.10	37.0	390	0.062	0.059	S35A2_MOUSE UDP-galactose translocator OS=Mus musculus OX=10090 GN=Slc35a2 PE=1 SV=1
16	Q381D0	0.11	37.0	441	0.073	0.061	Q381D0_TRYB2 CMP-sialic acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8280 PE=4 SV=1
17	P78381	0.13	36.6	396	0.062	0.058	S35A2_HUMAN UDP-galactose translocator OS=Homo sapiens OX=9606 GN=SLC35A2 PE=1 SV=1
18	B4DE15	0.16	36.2	406	0.062	0.057	B4DE15_HUMAN Solute carrier family 35 member A2 OS=Homo sapiens OX=9606 GN=SLC35A2 PE=1 SV=1
19	Q8LGE9	0.26	35.4	340	0.057	0.062	CSTR1_ARATH CMP-sialic acid transporter 1 OS=Arabidopsis thaliana OX=3702 GN=At5g41760 PE=2 SV=1
20	Q8RWL5	0.79	34.3	452	0.108	0.088	CLT3_ARATH Protein CLT3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLT3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08627 CRT-like	0.027	25.1	CRT-like, chloroquine-resistance transporter-like
2	PF00892 EamA	2.8e-10	51.9	EamA-like transporter family
3	PF05653 Mg_trans_NIPA	22	15.7	Magnesium transporter NIPA
4	PF04142 Nuc_sug_transp	3.9e-05	34.6	Nucleotide-sugar transporter
5	PF06027 SLC35F	2.2e-07	42.3	Solute carrier family 35
6	PF03151 TPT	0.013	26.5	Triose-phosphate Transporter family
7	PF08449 UAA	0.027	25.2	UAA transporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000345528

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360671	0.773	ADP/ATP translocase 2
2	9606.ENSP00000357480	0.682	Dehydrodolichyl diphosphate synthase complex subunit NUS1
3	9606.ENSP00000386935	0.681	UDP-N-acetylhexosamine pyrophosphorylase-like protein 1
4	9606.ENSP00000321266	0.672	Phosphatidylinositol transfer protein beta isoform
5	9606.ENSP00000409279	0.654	OTU domain-containing protein 4
6	9606.ENSP00000291565	0.643	Pyridoxal kinase
7	9606.ENSP00000359609	0.613	Probable lysosomal cobalamin transporter
8	9606.ENSP00000332915	0.611	PCNA-interacting partner
9	9606.ENSP00000476119	0.600	Diphosphoinositol polyphosphate phosphohydrolase 1
10	9606.ENSP00000261942	0.585	FAS-associated factor 2
11	9606.ENSP00000367992	0.584	S-formylglutathione hydrolase
12	9606.ENSP00000355493	0.578	Adenylosuccinate synthetase isozyme 2
13	9606.ENSP00000226578	0.572	Beta-mannosidase
14	9606.ENSP00000365944	0.570	F-box only protein 6
15	9606.ENSP00000306070	0.567	Nucleoside diphosphate-linked moiety X motif 6
16	9606.ENSP00000306397	0.547	Cytochrome b-c1 complex subunit Rieske, mitochondrial
17	9606.ENSP00000252992	0.535	Centrosomal protein of 85 kDa
18	9606.ENSP00000366927	0.533	Aldehyde dehydrogenase X, mitochondrial
19	9606.ENSP00000264718	0.523	GPN-loop GTPase 1
20	9606.ENSP00000219345	0.512	Group XV phospholipase A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.889	transporter activity
GO:0022857	0.855	transmembrane transporter activity
GO:1901505	0.691	carbohydrate derivative transmembrane transporter activity
GO:0008514	0.330	organic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0048523	0.975	negative regulation of cellular process
GO:0051179	0.946	localization
GO:0006810	0.899	transport
GO:0051128	0.742	regulation of cellular component organization
GO:0010941	0.713	regulation of cell death
GO:0010646	0.711	regulation of cell communication
GO:0071840	0.671	cellular component organization or biogenesis
GO:0033043	0.668	regulation of organelle organization
GO:0016043	0.627	cellular component organization
GO:0048583	0.618	regulation of response to stimulus
GO:0006996	0.557	organelle organization
GO:0048518	0.540	positive regulation of biological process
GO:0048522	0.528	positive regulation of cellular process
GO:0023051	0.491	regulation of signaling
GO:0010821	0.463	regulation of mitochondrion organization
GO:0042981	0.461	regulation of apoptotic process
GO:0009966	0.380	regulation of signal transduction
GO:0008152	0.379	metabolic process
GO:0051641	0.359	cellular localization
GO:0051649	0.350	establishment of localization in cell
GO:0048585	0.348	negative regulation of response to stimulus
GO:0046907	0.338	intracellular transport
GO:0051129	0.331	negative regulation of cellular component organization
GO:0009968	0.329	negative regulation of signal transduction
GO:0051049	0.311	regulation of transport
GO:0065008	0.307	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005764	0.996	lysosome
GO:0070013	0.990	intracellular organelle lumen
GO:0016020	0.948	membrane
GO:0031090	0.915	organelle membrane
GO:0005576	0.906	extracellular region
GO:0031981	0.861	nuclear lumen
GO:0005654	0.842	nucleoplasm
GO:0012505	0.836	endomembrane system
GO:0031982	0.827	vesicle
GO:0005829	0.640	cytosol
GO:0098588	0.601	bounding membrane of organelle
GO:0070062	0.596	extracellular exosome
GO:0005739	0.595	mitochondrion
GO:0005765	0.526	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]