StarFunc result for job id Q8N365

User Input

>input (385 residues)
MDSPSSVSSYSSYSLSSSFPTSPVNSDFGFPSDSEREDKGAHGPRPDTVGQRGGSRPSPG
PIRCRHRSKVSGNQHTPSHPKQRGSASPMAGSGAKRSRDGELETSLNTQGCTTEGDLLFA
QKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGT
LLQVEGMLKTWFPQIAAQKSSLGGGKHQLTKHFPSHHSDSAASSPASPMEKMDQTQLGHL
ALKPKQPWHLTQWPAMNLTWIHTTPICNPPLSSPGTISFSHGPLGTGTGIGVILFLQHGV
QPFTHSAPTTPVPPTTASPVIPGEPMKLSGEGPRCYSLPVTLPSDWSYTLSPPSLPTLAR
KMTIGHREQQRSHPPVAADAHLLNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N365	0.999	0.999	1.196E-48	385	1.000	1.000	Q8N365.pdb.gz	CIART_HUMAN Circadian-associated transcriptional repressor OS=Homo sapiens OX=9606 GN=CIART PE=1 SV=1
2	AFDB:Q3TQ03	0.615	0.627	7.184E-35	375	0.774	0.795	Q3TQ03.pdb.gz	CIART_MOUSE Circadian-associated transcriptional repressor OS=Mus musculus OX=10090 GN=Ciart PE=1 SV=1
3	AFDB:E7F9I2	0.077	0.070	1.090E-2	431	0.158	0.142	E7F9I2.pdb.gz	E7F9I2_DANRE SRY-box transcription factor 18 OS=Danio rerio OX=7955 GN=sox18 PE=4 SV=1
4	AFDB:Q8N693	0.078	0.075	3.060E-2	406	0.166	0.158	Q8N693.pdb.gz	ESX1_HUMAN Homeobox protein ESX1 OS=Homo sapiens OX=9606 GN=ESX1 PE=1 SV=3
5	AFDB:Q06453	0.085	0.083	9.071E-2	408	0.158	0.150	Q06453.pdb.gz	AL_DROME Homeobox protein aristaless OS=Drosophila melanogaster OX=7227 GN=al PE=1 SV=2
6	AFDB:Q90ZH8	0.075	0.078	1.068E-1	363	0.132	0.140	Q90ZH8.pdb.gz	SX18A_XENLA Transcription factor Sox-18A OS=Xenopus laevis OX=8355 GN=sox18-a PE=1 SV=1
7	AFDB:P56672	0.091	0.087	1.401E-1	409	0.153	0.144	P56672.pdb.gz	OTP_DROME Homeobox protein orthopedia OS=Drosophila melanogaster OX=7227 GN=otp PE=2 SV=2
8	AFDB:Q38B85	0.083	0.042	1.401E-1	973	0.140	0.055	Q38B85.pdb.gz	Q38B85_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1950 PE=4 SV=1
9	AFDB:Q8NFH8	0.111	0.077	1.838E-1	660	0.164	0.095	Q8NFH8.pdb.gz	REPS2_HUMAN RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens OX=9606 GN=REPS2 PE=1 SV=2
10	AFDB:Q9UN79	0.080	0.057	2.839E-1	622	0.195	0.121	Q9UN79.pdb.gz	SOX13_HUMAN Transcription factor SOX-13 OS=Homo sapiens OX=9606 GN=SOX13 PE=1 SV=3
11	PDB:1x8zA	0.105	0.214	1.028	151	0.044	0.113	1x8zA.pdb.gz
12	PDB:2qc7A	0.100	0.152	1.677	224	0.036	0.062	2qc7A.pdb.gz
13	PDB:5ee3B	0.097	0.102	2.084	364	0.016	0.016	5ee3B.pdb.gz	ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
14	PDB:6tz402	0.119	0.229	3.587	176	0.023	0.051	6tz402.pdb.gz
15	PDB:7b93V	0.074	0.162	3.787	115	0.057	0.191	7b93V.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
16	PDB:6lfmR	0.108	0.129	3.999	307	0.042	0.052	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
17	PDB:7aqrV	0.117	0.269	3.999	140	0.029	0.079	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
18	PDB:7qskV	0.084	0.119	3.999	115	0.052	0.174	7qskV.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
19	PDB:5n9jV	0.095	0.269	4.222	99	0.039	0.152	5n9jV.pdb.gz
20	PDB:5b5rA	0.094	0.090	4.458	409	0.055	0.051	5b5rA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3TQ03	0.0	544	375	0.725	0.744	CIART_MOUSE Circadian-associated transcriptional repressor OS=Mus musculus OX=10090 GN=Ciart PE=1 SV=1
2	Q8N365	0.0	780	385	1.000	1.000	CIART_HUMAN Circadian-associated transcriptional repressor OS=Homo sapiens OX=9606 GN=CIART PE=1 SV=1
3	P9WHN1	3.3	32.0	297	0.044	0.057	PUR7_MYCTU Phosphoribosylaminoimidazole-succinocarboxamide synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=purC PE=1 SV=1
4	Q8SCY1	5.7	32.0	2237	0.049	0.008	EXLYS_BPDPK Peptidoglycan hydrolase gp181 OS=Pseudomonas phage phiKZ OX=2905945 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15673 Ciart	1.8e-167	567.3	Circadian-associated transcriptional repressor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290363

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384517	0.816	Aryl hydrocarbon receptor nuclear translocator-like protein 1
2	9606.ENSP00000351138	0.709	Mitoguardin 2
3	9606.ENSP00000308741	0.650	Circadian locomoter output cycles protein kaput
4	9606.ENSP00000482093	0.617	Period circadian protein homolog 3
5	9606.ENSP00000355319	0.614	CLOCK-interacting pacemaker
6	9606.ENSP00000478187	0.611	Cryptochrome-2
7	9606.ENSP00000008527	0.599	Cryptochrome-1
8	9606.ENSP00000246672	0.596	Nuclear receptor subfamily 1 group D member 1
9	9606.ENSP00000254657	0.577	Period circadian protein homolog 2
10	9606.ENSP00000338283	0.571	Neuronal PAS domain-containing protein 2
11	9606.ENSP00000310006	0.554	Nuclear receptor subfamily 1 group D member 2
12	9606.ENSP00000242728	0.544	Class E basic helix-loop-helix protein 41
13	9606.ENSP00000257696	0.508	Hypoxia-inducible lipid droplet-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.708	DNA binding
GO:0000976	0.567	transcription cis-regulatory region binding
GO:0000977	0.471	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.457	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0060255	0.972	regulation of macromolecule metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0051171	0.971	regulation of nitrogen compound metabolic process
GO:0006355	0.955	regulation of DNA-templated transcription
GO:0048511	0.949	rhythmic process
GO:0048523	0.940	negative regulation of cellular process
GO:0009892	0.936	negative regulation of metabolic process
GO:0007623	0.897	circadian rhythm
GO:0010605	0.853	negative regulation of macromolecule metabolic process
GO:0032501	0.844	multicellular organismal process
GO:0032922	0.819	circadian regulation of gene expression
GO:0045892	0.785	negative regulation of DNA-templated transcription
GO:0007622	0.686	rhythmic behavior
GO:0007626	0.570	locomotory behavior
GO:0048512	0.567	circadian behavior
GO:0045475	0.531	locomotor rhythm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.920	nuclear lumen
GO:0005654	0.903	nucleoplasm
GO:0005737	0.655	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]