StarFunc result for job id Q8N371

User Input

>input (416 residues)
MAGDTHCPAEPLAREGTLWEALRALLPHSKEDLKLDLGEKVERSVVTLLQRATELFYEGR
RDECLQSSEVILDYSWEKLNTGTWQDVDKDWRRVYAIGCLLKALCLCQAPEDANTVAAAL
RVCDMGLLMGAAILGDILLKVAAILQTHLPGKRPARGSLPEQPCTKKARADHGLIPDVKL
EKTVPRLHRPSLQHFREQFLVPGRPVILKGVADHWPCMQKWSLEYIQEIAGCRTVPVEVG
SRYTDEEWSQTLMTVNEFISKYIVNEPRDVGYLAQHQLFDQIPELKQDISIPDYCSLGDG
EEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKYIRLYSPQESGALYPHDTHLLHNT
SQVDVENPDLEKFPKFAKAPFLSCILSPGEILFIPVKYWHYVRALDLSFSVSFWWS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z5T1	0.972	0.972	5.453E-84	416	1.000	1.000	A0A0S2Z5T1.pdb.gz	A0A0S2Z5T1_HUMAN Jumonji domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=JMJD5 PE=2 SV=1
2	AFDB:Q9CXT6	0.942	0.947	6.844E-69	414	0.764	0.768	Q9CXT6.pdb.gz	KDM8_MOUSE Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Mus musculus OX=10090 GN=Kdm8 PE=1 SV=1
3	AFDB:Q9W0M3	0.843	0.873	6.047E-42	401	0.349	0.362	Q9W0M3.pdb.gz	Q9W0M3_DROME GM21055p OS=Drosophila melanogaster OX=7227 GN=JMJD5 PE=2 SV=2
4	AFDB:Q8RWR1	0.748	0.727	2.386E-38	429	0.380	0.368	Q8RWR1.pdb.gz	JMJ30_ARATH Lysine-specific demethylase JMJ30 OS=Arabidopsis thaliana OX=3702 GN=JMJ30 PE=1 SV=1
5	AFDB:A2RUC4	0.506	0.662	3.317E-21	315	0.161	0.213	A2RUC4.pdb.gz	TYW5_HUMAN tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1
6	PDB:4qszA	0.478	0.296	1.070E-19	686	0.178	0.108	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
7	PDB:3al5B	0.501	0.662	1.504E-19	311	0.156	0.209	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
8	PDB:7yxgA	0.481	0.630	1.824E-18	313	0.151	0.201	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
9	AFDB:P0C870	0.478	0.622	3.355E-18	316	0.149	0.196	P0C870.pdb.gz	JMJD7_HUMAN Bifunctional peptidase and (3S)-lysyl hydroxylase JMJD7 OS=Homo sapiens OX=9606 GN=JMJD7 PE=1 SV=1
10	PDB:5nfnB	0.490	0.631	3.403E-18	318	0.149	0.195	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
11	AFDB:Q9VU77	0.487	0.632	7.422E-18	316	0.144	0.190	Q9VU77.pdb.gz	Q9VU77_DROME GH14974p OS=Drosophila melanogaster OX=7227 GN=JMJD7 PE=1 SV=1
12	AFDB:Q38DD6	0.496	0.187	8.313E-18	1145	0.171	0.062	Q38DD6.pdb.gz	Q38DD6_TRYB2 tRNA wybutosine-synthesizing protein 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3730 PE=3 SV=1
13	PDB:3al5C	0.456	0.654	1.254E-17	284	0.163	0.239	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
14	AFDB:P59723	0.497	0.593	1.946E-17	344	0.171	0.206	P59723.pdb.gz	HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio OX=7955 GN=hif1an PE=2 SV=2
15	AFDB:Q8BLR9	0.476	0.561	2.585E-17	349	0.166	0.198	Q8BLR9.pdb.gz	HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus OX=10090 GN=Hif1an PE=1 SV=2
16	PDB:4b7eA	0.479	0.565	2.937E-17	349	0.173	0.206	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
17	PDB:4bxfA	0.340	0.334	7.116E-8	425	0.099	0.096	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	PDB:4bu2A	0.302	0.327	2.938E-7	379	0.096	0.106	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
19	PDB:4cclB	0.321	0.354	3.109E-7	372	0.106	0.118	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
20	PDB:1ipkC	0.191	0.208	9.558E-5	379	0.048	0.053	1ipkC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5T1	0.0	861	416	1.000	1.000	A0A0S2Z5T1_HUMAN Jumonji domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=JMJD5 PE=2 SV=1
2	Q8N371	0.0	861	416	1.000	1.000	KDM8_HUMAN Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8 PE=1 SV=1
3	Q9CXT6	0.0	674	414	0.779	0.783	KDM8_MOUSE Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Mus musculus OX=10090 GN=Kdm8 PE=1 SV=1
4	Q8RWR1	9.92e-87	272	429	0.373	0.361	JMJ30_ARATH Lysine-specific demethylase JMJ30 OS=Arabidopsis thaliana OX=3702 GN=JMJ30 PE=1 SV=1
5	Q9W0M3	2.02e-80	255	401	0.334	0.347	Q9W0M3_DROME GM21055p OS=Drosophila melanogaster OX=7227 GN=JMJD5 PE=2 SV=2
6	A2RUC4	7.90e-23	100	315	0.161	0.213	TYW5_HUMAN tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1
7	P59723	7.44e-20	92.0	344	0.171	0.206	HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio OX=7955 GN=hif1an PE=2 SV=2
8	Q9NWT6	2.36e-19	90.9	349	0.173	0.206	HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens OX=9606 GN=HIF1AN PE=1 SV=2
9	P0C870	4.06e-19	89.7	316	0.171	0.225	JMJD7_HUMAN Bifunctional peptidase and (3S)-lysyl hydroxylase JMJD7 OS=Homo sapiens OX=9606 GN=JMJD7 PE=1 SV=1
10	Q8BLR9	5.06e-19	89.7	349	0.171	0.203	HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus OX=10090 GN=Hif1an PE=1 SV=2
11	Q96EW2	2.03e-18	89.4	488	0.163	0.139	HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens OX=9606 GN=HSPBAP1 PE=1 SV=1
12	Q9VU77	3.61e-16	80.9	316	0.151	0.199	Q9VU77_DROME GH14974p OS=Drosophila melanogaster OX=7227 GN=JMJD7 PE=1 SV=1
13	Q67XX3	3.56e-11	67.0	502	0.154	0.127	JMJ22_ARATH Arginine-specific demethylase JMJ22 OS=Arabidopsis thaliana OX=3702 GN=JMJ22 PE=1 SV=1
14	Q38DD6	2.55e-09	61.6	1145	0.075	0.027	Q38DD6_TRYB2 tRNA wybutosine-synthesizing protein 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3730 PE=3 SV=1
15	Q67ZB6	3.50e-09	60.8	462	0.139	0.126	JMJ20_ARATH Arginine-specific demethylase JMJ20 OS=Arabidopsis thaliana OX=3702 GN=JMJ20 PE=1 SV=1
16	Q9VB06	4.85e-07	53.9	398	0.123	0.128	Q9VB06_DROME HSPB1 associated protein 1 OS=Drosophila melanogaster OX=7227 GN=HSPBAP1 PE=4 SV=3
17	Q9H9V9	1.66e-06	52.4	463	0.142	0.127	JMJD4_HUMAN 2-oxoglutarate and iron-dependent oxygenase JMJD4 OS=Homo sapiens OX=9606 GN=JMJD4 PE=1 SV=2
18	Q9GYI4	7.90e-06	50.1	400	0.139	0.145	JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans OX=6239 GN=psr-1 PE=1 SV=2
19	Q96S16	2.67e-05	47.8	264	0.123	0.193	JMJD8_HUMAN JmjC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=JMJD8 PE=1 SV=2
20	Q6Q4H1	4.07e-05	47.8	385	0.168	0.182	JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris OX=6087 GN=PSR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13621 Cupin_8	4.7e-42	156.1	Cupin-like domain
2	PF02373 JmjC	35	16.3	JmjC domain, hydroxylase
3	PF08007 JmjC_2	3.1e-06	38.2	JmjC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398410

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320171	0.986	Pyruvate kinase PKM
2	9606.ENSP00000377801	0.902	RCC1 domain-containing protein 1
3	9606.ENSP00000477507	0.823	Ribosomal oxygenase 1
4	9606.ENSP00000369757	0.800	40S ribosomal protein S6
5	9606.ENSP00000340823	0.792	General transcription factor IIF subunit 2
6	9606.ENSP00000394085	0.767	Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
7	9606.ENSP00000465776	0.741	Coiled-coil domain containing 130
8	9606.ENSP00000339917	0.732	Transcription initiation factor TFIID subunit 9B
9	9606.ENSP00000370193	0.732	Transcription initiation factor TFIID subunit 9
10	9606.ENSP00000347232	0.720	Bloom syndrome protein
11	9606.ENSP00000379838	0.687	Calcium-regulated heat-stable protein 1
12	9606.ENSP00000454646	0.684	Putative sodium-coupled neutral amino acid transporter 7
13	9606.ENSP00000438115	0.672	COP9 signalosome complex subunit 7a
14	9606.ENSP00000442050	0.640	Ethanolamine-phosphate cytidylyltransferase
15	9606.ENSP00000326563	0.635	Lysine-specific demethylase 3B
16	9606.ENSP00000328251	0.628	Ribosomal oxygenase 2
17	9606.ENSP00000432786	0.628	Lysine-specific demethylase 2A
18	9606.ENSP00000380692	0.622	Lysine-specific demethylase 7A
19	9606.ENSP00000350676	0.620	Histone lysine demethylase PHF8
20	9606.ENSP00000380544	0.617	2-oxoglutarate and iron dependent oxygenase domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140096	0.999	catalytic activity, acting on a protein
GO:0005515	0.999	protein binding
GO:0016706	0.990	2-oxoglutarate-dependent dioxygenase activity
GO:0032451	0.980	demethylase activity
GO:0032452	0.970	histone demethylase activity
GO:0042393	0.917	histone binding
GO:0140030	0.787	modification-dependent protein binding
GO:0003676	0.739	nucleic acid binding
GO:0140034	0.559	methylation-dependent protein binding
GO:0035064	0.550	methylated histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.997	regulation of metabolic process
GO:0051171	0.991	regulation of nitrogen compound metabolic process
GO:0031648	0.991	protein destabilization
GO:0031323	0.991	regulation of cellular metabolic process
GO:0009889	0.987	regulation of biosynthetic process
GO:0009987	0.986	cellular process
GO:0080090	0.986	regulation of primary metabolic process
GO:0010468	0.986	regulation of gene expression
GO:0010556	0.977	regulation of macromolecule biosynthetic process
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.972	regulation of RNA metabolic process
GO:0031326	0.967	regulation of cellular biosynthetic process
GO:0048518	0.865	positive regulation of biological process
GO:0006355	0.861	regulation of DNA-templated transcription
GO:0009893	0.849	positive regulation of metabolic process
GO:0010604	0.842	positive regulation of macromolecule metabolic process
GO:0044770	0.817	cell cycle phase transition
GO:0044839	0.748	cell cycle G2/M phase transition
GO:0048522	0.692	positive regulation of cellular process
GO:0051173	0.676	positive regulation of nitrogen compound metabolic process
GO:0031325	0.627	positive regulation of cellular metabolic process
GO:0000278	0.589	mitotic cell cycle
GO:0010557	0.462	positive regulation of macromolecule biosynthetic process
GO:0031328	0.456	positive regulation of cellular biosynthetic process
GO:0048519	0.450	negative regulation of biological process
GO:0045893	0.449	positive regulation of DNA-templated transcription
GO:0048523	0.442	negative regulation of cellular process
GO:0071704	0.388	organic substance metabolic process
GO:0044772	0.357	mitotic cell cycle phase transition
GO:0044238	0.346	primary metabolic process
GO:0000086	0.332	G2/M transition of mitotic cell cycle
GO:0009892	0.321	negative regulation of metabolic process
GO:0006807	0.320	nitrogen compound metabolic process
GO:0051253	0.305	negative regulation of RNA metabolic process
GO:0010558	0.301	negative regulation of macromolecule biosynthetic process
GO:0031327	0.301	negative regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	0.990	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.

[back to server]