StarFunc result for job id Q8N398

User Input

>input (1242 residues)
MPGLYCPSSWTPLPLTDSWVRACANGPCLSVRARLTYRNPQPQPVDGVFVYPLAEAEVVS
GFEAEAAGRRVSFQLQSRRRSQAACCRALGPGLGTPTPRRCAQGHLVLDLAQARSTLVLP
TGIIAAAGTMTVTLHSSRELPSRPDGVLHVALPTVLTPLAPPGPPGPPRPPGLCDDSPTS
CFGVGSLQEEGLAWEELAAPRDVFSGPARCPAPYTFSFEMLVTGPCLLAGLESPSHALRA
DAPPHASSAATICVTLAEGHHCDRALEILLHPSEPHQPHLMLEGGSLSSAEYEARVRARR
DFQRLQRRDSDGDRQVWFLQRRFHKDILLNPVLALSFCPDLSSKPGHLGTATRELLFLLD
SSSVAHKDAIVLAVKSLPPQTLINLAVFGTLVQPLFPESRPCSDDAVQLICESIETLQVP
SGPPDVLAALDWAVGQPQHRAYPRQLFLLTAASPMAATTHRTLELMRWHRGTARCFSFGL
GPTCHQLLQGLSALSRGQAYFLRPGQRLQPMLVQALRKALEPALSDISVDWFVPDTVEAL
LTPREIPALYPGDQLLGYCSLFRVDGFRSRPPGGQEPGWQSSGGSVFPSPEEAPSAASPG
TEPTGTSEPLGTGTVSAELSSPWAARDSEQSTDALTDPVTDPGPNPSDTAIWRRIFQSSY
IREQYVLTHCSASPEPGPGSTGSSESPGSQGPGSPEGSAPLEPPSQQGCRSLAWGEPAGS
RSCPLPAPTPAPFKVGALSTEVLGRQHRAALAGRSLSSPPGRANQVPGRPRKPSLGAILD
GPSPEPGQQLGQGLDDSGNLLSPAPMDWDMLMEPPFLFTAVPPSGELAPPAVPPQAPRCH
VVIRGLCGEQPMCWEVGVGLETLWGPGDGSQPPSPPVREAAWDQALHRLTAASVVRDNEQ
LALRGGAETTADRGHARRCWLRALQTSKVSSAPSCFTCPVAVDATTREVLPGALQVCSSE
PAEPPGTPPASHSHLDAAPLPTVVYSKGLQRGSPAGAWDSDQNGNSKRALGDPATPTEGP
RRPPPRPPCRLSMGRRHKLCSPDPGQANNSEGSDHDYLPLVRLQEAPGSFRLDAPFCAAV
RISQERLCRASPFAVHRASLSPTSASLPWALLGPGVGQGDSATASCSPSPSSGSEGPGQV
DSGRGSDTEASEGAEGLGGTDLRGRTWATAVALAWLEHRCAAAFDEWELTAAKADCWLRA
QHLPDGLDLAALKAAARGLFLLLRHWDQNLQLHLLCYSPANV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PYK3	0.258	0.174	4.732E-29	1969	0.182	0.115	E9PYK3.pdb.gz	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
2	PDB:6jp8F	0.122	0.152	3.875E-7	973	0.034	0.043	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
3	PDB:6rqxA	0.103	0.141	4.977E-7	862	0.024	0.035	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
4	PDB:3mdjC	0.103	0.147	6.081E-7	819	0.024	0.037	3mdjC.pdb.gz	Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.
5	PDB:7nupD	0.093	0.125	1.498E-6	884	0.020	0.028	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand
6	PDB:1m2vA	0.124	0.199	1.741E-6	705	0.030	0.052	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
7	PDB:5k1vB	0.095	0.131	1.056E-5	849	0.022	0.032	5k1vB.pdb.gz	Crystal Structures of ERAP2 Complexed with Inhibitors Reveal Pharmacophore Requirements for Optimizing Inhibitor Potency.
8	PDB:6zgaB	0.126	0.185	1.056E-5	786	0.023	0.037	6zgaB.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
9	PDB:7zs96	0.118	0.340	1.426E-5	383	0.027	0.089	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
10	PDB:5lhdC	0.104	0.136	1.576E-5	905	0.026	0.035	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.
11	PDB:5kynA	0.131	0.207	1.926E-5	730	0.033	0.056	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.
12	AFDB:Q8NFW1	0.123	0.096	1.783E-4	1626	0.132	0.101	Q8NFW1.pdb.gz	COMA1_HUMAN Collagen alpha-1(XXII) chain OS=Homo sapiens OX=9606 GN=COL22A1 PE=2 SV=2
13	AFDB:E9Q7P1	0.116	0.092	4.391E-4	1613	0.123	0.095	E9Q7P1.pdb.gz	E9Q7P1_MOUSE Collagen, type XXII, alpha 1 OS=Mus musculus OX=10090 GN=Col22a1 PE=1 SV=1
14	AFDB:Q2UY11	0.112	0.122	8.852E-4	1141	0.101	0.110	Q2UY11.pdb.gz	COSA1_MOUSE Collagen alpha-1(XXVIII) chain OS=Mus musculus OX=10090 GN=Col28a1 PE=2 SV=1
15	AFDB:A0A0R4IR54	0.105	0.082	6.905E-2	1622	0.111	0.085	A0A0R4IR54.pdb.gz
16	AFDB:Q8NE31	0.040	0.077	5.118E-1	585	0.076	0.162	Q8NE31.pdb.gz	FA13C_HUMAN Protein FAM13C OS=Homo sapiens OX=9606 GN=FAM13C PE=1 SV=2
17	AFDB:Q14678	0.045	0.042	7.267E-1	1352	0.069	0.064	Q14678.pdb.gz	KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KANK1 PE=1 SV=3
18	AFDB:Q59XA7	0.026	0.026	1.540	1249	0.074	0.074	Q59XA7.pdb.gz	HYR3_CANAL Hyphally regulated cell wall protein 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HYR3 PE=1 SV=1
19	AFDB:Q1W9P9	0.035	0.027	1.703	1765	0.081	0.057	Q1W9P9.pdb.gz	Q1W9P9_DROME Echinus splice form 3 OS=Drosophila melanogaster OX=7227 GN=ec PE=2 SV=1
20	AFDB:Q5TC82	0.034	0.036	1.979	1133	0.079	0.086	Q5TC82.pdb.gz	RC3H1_HUMAN Roquin-1 OS=Homo sapiens OX=9606 GN=RC3H1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00534	1.17e-34	145	786	0.112	0.177	VMA5A_HUMAN von Willebrand factor A domain-containing protein 5A OS=Homo sapiens OX=9606 GN=VWA5A PE=1 SV=2
2	Q99KC8	5.77e-33	140	793	0.114	0.179	VMA5A_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus OX=10090 GN=Vwa5a PE=1 SV=2
3	Q8C1D4	2.06e-32	138	804	0.108	0.167	Q8C1D4_MOUSE von Willebrand factor A domain-containing protein 5A OS=Mus musculus OX=10090 GN=AW551984 PE=2 SV=1
4	Q8BGF0	2.43e-32	138	804	0.108	0.167	Q8BGF0_MOUSE Expressed sequence AW551984 OS=Mus musculus OX=10090 GN=AW551984 PE=1 SV=1
5	B4DHS6	3.14e-18	91.3	431	0.093	0.267	B4DHS6_HUMAN cDNA FLJ55206, highly similar to Loss of heterozygosity 11 chromosomal region 2 gene A protein OS=Homo sapiens OX=9606 GN=VWA5A PE=1 SV=1
6	Q6P8K4	9.56e-16	85.1	763	0.047	0.076	Q6P8K4_MOUSE AW551984 protein OS=Mus musculus OX=10090 GN=AW551984 PE=2 SV=1
7	D3Z518	3.70e-09	60.5	210	0.032	0.190	D3Z518_MOUSE Expressed sequence AW551984 (Fragment) OS=Mus musculus OX=10090 GN=AW551984 PE=1 SV=1
8	Q54LJ4	1.10e-07	59.3	2563	0.089	0.043	Q54LJ4_DICDI Poly [ADP-ribose] polymerase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286613 PE=3 SV=1
9	E9PYK3	1.53e-06	55.5	1969	0.093	0.059	PARP4_MOUSE Protein mono-ADP-ribosyltransferase PARP4 OS=Mus musculus OX=10090 GN=Parp4 PE=1 SV=1
10	Q9UKK3	5.62e-04	47.0	1724	0.052	0.038	PARP4_HUMAN Protein mono-ADP-ribosyltransferase PARP4 OS=Homo sapiens OX=9606 GN=PARP4 PE=1 SV=3
11	Q86UX2	0.095	39.7	942	0.056	0.073	ITIH5_HUMAN Inter-alpha-trypsin inhibitor heavy chain H5 OS=Homo sapiens OX=9606 GN=ITIH5 PE=2 SV=2
12	A0A0K6FU48	2.1	34.3	218	0.017	0.096	A0A0K6FU48_9AGAM LysM domain-containing protein OS=Rhizoctonia solani OX=456999 GN=RSOLAG22IIIB_04067 PE=4 SV=1
13	F1S285	3.8	34.3	1760	0.013	0.009	F1S285_PIG Collagen type XIV alpha 1 chain OS=Sus scrofa OX=9823 GN=COL14A1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08487 VIT	0.39	22.3	Vault protein inter-alpha-trypsin domain
2	PF13757 VIT_2	2.3e-30	115.6	Vault protein inter-alpha-trypsin domain
3	PF13768 VWA_3	5.8e-34	128.8	von Willebrand factor type A domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398688

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253193	0.783	Low-density lipoprotein receptor-related protein 3
2	9606.ENSP00000376188	0.723	Cytokine receptor-like factor 1
3	9606.ENSP00000450114	0.669	Uncharacterized protein CLBA1
4	9606.ENSP00000329360	0.633	Coiled-coil domain containing 137
5	9606.ENSP00000484060	0.626	Protein kinase C and casein kinase substrate in neurons protein 1
6	9606.ENSP00000373360	0.623	Protein FAM131A
7	9606.ENSP00000309186	0.613	SH3 domain containing ring finger 3
8	9606.ENSP00000314560	0.607	MAP6 domain-containing protein 1
9	9606.ENSP00000296238	0.569	Calcium/calmodulin-dependent protein kinase II inhibitor 2
10	9606.ENSP00000365162	0.566	Myosin light chain kinase 2, skeletal/cardiac muscle
11	9606.ENSP00000411471	0.556	ATP-binding cassette sub-family F member 3
12	9606.ENSP00000380793	0.545	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
13	9606.ENSP00000306983	0.522	YEATS domain-containing protein 2
14	9606.ENSP00000395012	0.507	Kelch-like protein 24
15	9606.ENSP00000273783	0.504	Translation initiation factor eIF-2B subunit epsilon

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0065007	0.775	biological regulation
GO:0032502	0.557	developmental process
GO:0048856	0.503	anatomical structure development
GO:0032501	0.479	multicellular organismal process
GO:0050789	0.462	regulation of biological process
GO:0050794	0.394	regulation of cellular process
GO:0007275	0.367	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070013	0.999	intracellular organelle lumen
GO:0005634	0.998	nucleus
GO:0031981	0.989	nuclear lumen
GO:0005737	0.962	cytoplasm
GO:0005654	0.956	nucleoplasm
GO:0016020	0.483	membrane
GO:0012505	0.373	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]